POLR3C Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• POLR3C Polyclonal antibody, PBS Only (27864-1-PBS)

• 

  WB analysis using 27864-1-AP (same clone as 27864-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27864-1-AP (POLR3C antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27864-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 27864-1-AP (same clone as 27864-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 27864-1-AP (POLR3C antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27864-1-PBS in a different storage buffer formulation.

POLR3C Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 27864-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

DNA-directed RNA polymerase III subunit C, DNA-directed RNA polymerase III subunit RPC3, RNA polymerase III subunit C3, RPC3, RPC62

---

Product Information

27864-1-PBS targets POLR3C in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27311

  Product name: Recombinant human POLR3C protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 196-397 aa of BC002586

  Sequence: IGKGKRRRSSDEDAAGEPKAKRPKYTTDNKEPIPDDGIYWQANLDRFHQHFRDQAIVSAVANRMDQTSSEIVRTMLRMSEITTSSSAPFTQPLSSNEIFRSLPVGYNISKQVLDQYLTLLADDPLEFVGKSGDSGGGMYVINLHKALASLATATLESVVQERFGSRCARIFRLVLQKKHIEQKQVEDFAMIPAKEAKDMLYK

• Full Name: polymerase (RNA) III (DNA directed) polypeptide C (62kD)
• Calculated Molecular Weight: 61 kDa
• Observed Molecular Weight: 58 kDa
• GenBank Accession Number: BC002586
• Gene Symbol: POLR3C
• Gene ID (NCBI): 10623
• RRID: AB_3669626
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BUI4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Mutations in the POLR3A, POLR3C, POLR3E, and POLR3F subunits are associated with susceptibility to varicella zoster virus-induced encephalitis and pneumonitis (PMID: 34395528).