POMP Polyclonal antibody

• 

  WB analysis of HeLa using 15046-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 15046-1-AP (POMP Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 15046-1-AP

  WB result of POMP antibody (15046-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-POMP transfected HepG2 cells.

• 

  WB analysis of HepG2 using 15046-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 15046-1-AP (POMP antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of L02 using 15046-1-AP

  L02 cells were subjected to SDS PAGE followed by western blot with 15046-1-AP (POMP antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver using 15046-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 15046-1-AP (POMP Antibody) at dilution of 1:50.

• 

  IHC staining of human liver using 15046-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 15046-1-AP (POMP Antibody) at dilution of 1:50.

• 

  IHC staining of human skin using 15046-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 15046-1-AP (POMP Antibody) at dilution of 1:50.

• 

  IHC staining of human skin using 15046-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 15046-1-AP (POMP Antibody) at dilution of 1:50.

• 

  IF Staining of HepG2 using 15046-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using POMP antibody (15046-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002).

• 

  IF Staining of HeLa using 15046-1-AP

  Immunofluorescent analysis of Hela cells, using POMP antibody 15046-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). Blue pseudocolor = DAPI (fluorescent DNA dye).

• Featured Product
• KD/KO Validated

POMP Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 15046-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

PNAS-110, PNAS 110, hUMP1, HSPC036, HSPC014

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, L02 cells
• Positive IHC detected in: human liver tissue, human skin tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 3 publications below

Product Information

15046-1-AP targets POMP in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6987

  Product name: Recombinant human POMP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-141 aa of BC003390

  Sequence: MNARGLGSELKDSIPVTELSASGPFESHDLLRKGFSCVKNELLPSHPLELSEKNFQLNQDKMNFSTLRNIQGLFAPLKLQMEFKAVQQVQRLPFLSSSNLSLDVLRGNDETIGFEDILNDPSQSEVMGEPHLMVEYKLGLL

• Full Name: proteasome maturation protein
• Calculated Molecular Weight: 16 kDa
• Observed Molecular Weight: 16 kDa
• GenBank Accession Number: BC003390
• Gene Symbol: POMP
• Gene ID (NCBI): 51371
• RRID: AB_10858321
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y244
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Dermatol Sci; The proteasome maturation protein POMP increases proteasome assembly and activity in psoriatic lesional skin.; Authors - Barbara A Zieba ; KD Validated
mouse	WB	JCI Insight; Blockade of the CXCR3/CXCL10 axis ameliorates inflammation caused by immunoproteasome dysfunction.; Authors - Yuki Sasaki
mouse	WB	Int Immunol; Proteasome dysfunction in T cells causes immunodeficiency via cell cycle disruption and apoptosis; Authors - Erkhembayar Shinebaatar