Home
Products
Primary Antibodies
POPDC3 Polyclonal antibody, PBS Only (11800-1-PBS)

Filter: AllWBIPIHC

WB analysis of COLO 320 using 11800-1-AP (same clone as 11800-1-PBS)
COLO 320 cells were subjected to SDS PAGE followed by western blot with 11800-1-AP (POPDC3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11800-1-PBS in a different storage buffer formulation.
WB analysis using 11800-1-AP (same clone as 11800-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 11800-1-AP (POPDC3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11800-1-PBS in a different storage buffer formulation.
WB analysis of HEK-293 using 11800-1-AP (same clone as 11800-1-PBS)
HEK-293 cells were subjected to SDS PAGE followed by western blot with 11800-1-AP (POPDC3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11800-1-PBS in a different storage buffer formulation.
IP experiment of HeLa using 11800-1-AP (same clone as 11800-1-PBS)
IP result of anti-POPDC3 (IP:11800-1-AP, 3ug; Detection:11800-1-AP 1:1000) with HeLa cells lysate 220ug. This data was developed using the same antibody clone with 11800-1-PBS in a different storage buffer formulation.
IHC staining of mouse heart using 11800-1-AP (same clone as 11800-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 11800-1-AP (POPDC3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11800-1-PBS in a different storage buffer formulation.
IHC staining of mouse heart using 11800-1-AP (same clone as 11800-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 11800-1-AP (POPDC3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11800-1-PBS in a different storage buffer formulation.
IHC staining of mouse heart using 11800-1-AP (same clone as 11800-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 11800-1-AP (POPDC3 antibody) at dilution of 1:50 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11800-1-PBS in a different storage buffer formulation.
IHC staining of mouse heart using 11800-1-AP (same clone as 11800-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 11800-1-AP (POPDC3 antibody) at dilution of 1:50 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11800-1-PBS in a different storage buffer formulation.
IHC staining of human skeletal muscle using 11800-1-AP (same clone as 11800-1-PBS)
Immunohistochemical analysis of paraffin-embedded human skeletal muscle slide using 11800-1-AP (POPDC3 Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 11800-1-PBS in a different storage buffer formulation.
IHC staining of human skeletal muscle using 11800-1-AP (same clone as 11800-1-PBS)
Immunohistochemical analysis of paraffin-embedded human skeletal muscle slide using 11800-1-AP (POPDC3 Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 11800-1-PBS in a different storage buffer formulation.
IHC staining of human spleen using 11800-1-AP (same clone as 11800-1-PBS)
Immunohistochemical analysis of paraffin-embedded human spleen using 11800-1-AP (POPDC3 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11800-1-PBS in a different storage buffer formulation.
IHC staining of human spleen using 11800-1-AP (same clone as 11800-1-PBS)
Immunohistochemical analysis of paraffin-embedded human spleen using 11800-1-AP (POPDC3 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 11800-1-PBS in a different storage buffer formulation.
IHC staining of human lung using 11800-1-AP (same clone as 11800-1-PBS)
Immunohistochemical analysis of paraffin-embedded human lung using 11800-1-AP (POPDC3 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11800-1-PBS in a different storage buffer formulation.
IHC staining of human lung using 11800-1-AP (same clone as 11800-1-PBS)
Immunohistochemical analysis of paraffin-embedded human lung using 11800-1-AP (POPDC3 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 11800-1-PBS in a different storage buffer formulation.
IHC staining of human placenta using 11800-1-AP (same clone as 11800-1-PBS)
Immunohistochemical analysis of paraffin-embedded human placenta using 11800-1-AP (POPDC3 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11800-1-PBS in a different storage buffer formulation.
IHC staining of human placenta using 11800-1-AP (same clone as 11800-1-PBS)
Immunohistochemical analysis of paraffin-embedded human placenta using 11800-1-AP (POPDC3 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 11800-1-PBS in a different storage buffer formulation.
IHC staining of human testis using 11800-1-AP (same clone as 11800-1-PBS)
Immunohistochemical analysis of paraffin-embedded human testis using 11800-1-AP (POPDC3 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11800-1-PBS in a different storage buffer formulation.
IHC staining of human testis using 11800-1-AP (same clone as 11800-1-PBS)
Immunohistochemical analysis of paraffin-embedded human testis using 11800-1-AP (POPDC3 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 11800-1-PBS in a different storage buffer formulation.

Featured Product
KD/KO Validated

POPDC3 Polyclonal antibody, PBS Only

Name: POPDC3 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 11800-1-PBS

POPDC3 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 11800-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

11800-1-PBS targets POPDC3 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag2375 Product name: Recombinant human POPDC3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-291 aa of BC022323 Sequence: MERNSSLWKNLIDEHPVCTTWKQEAEGAIYHLASILFVVGFMGGSGFFGLLYVFSLLGLGFLCSAVWAWVDVCAADIFSWNFVLFVICFMQFVHIAYQVRSITFAREFQVLYSSLFQPLGISLPVFRTIALSSEVVTLEKEHCYAMQGKTSIDKLSLLVSGRIRVTVDGEFLHYIFPLQFLDSPEWDSLRPTEEGIFQVTLTAETDCRYVSWRRKKLYLLFAQHRYISRLFSVLIGSDIADKLYALNDRVYIGKRYHYDIRLPNFYQMSTPEIRRSPLTQHFQNSRRYCDK Predict reactive species
Full Name	popeye domain containing 3
Calculated Molecular Weight	34 kDa
Observed Molecular Weight	60 kDa
GenBank Accession Number	BC022323
Gene Symbol	POPDC3
Gene ID (NCBI)	64208
RRID	AB_2166494
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9HBV1
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

The Popeye domain-containing (POPDC) gene family includes BVES/POPDC1, POPDC2 and POPDC3. POPDC proteins are highly evolutionarily conserved transmembrane proteins expressed in embryonic epithelium, heart and muscle. POPDC3 is a 291-amino acid protein containing three putative transmembrane domains. It has been reported that POPDC3 expression is reduced in gastric cancer, suggesting it might play an important role in the progression and metastases of gastric cancer. (PMID: 10882522; 20627872; 22654436)