POTEH Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• POTEH Polyclonal antibody, PBS Only (24837-1-PBS)

• 

  WB analysis of DU 145 using 24837-1-AP (same clone as 24837-1-PBS)

  DU 145 cells were subjected to SDS PAGE followed by western blot with 24837-1-AP (POTEH Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24837-1-PBS in a different storage buffer formulation.

• 

  WB analysis of DU 145 using 24837-1-AP (same clone as 24837-1-PBS)

  DU 145 cells were subjected to SDS PAGE followed by western blot with 24837-1-AP (POTEH Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24837-1-PBS in a different storage buffer formulation.

POTEH Polyclonal Antibody for WB, Indirect ELISA

Cat No. 24837-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

24837-1-PBS targets POTEH in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20275

  Product name: Recombinant human POTEH protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 24-59 aa of BC148758

  Sequence: MGKWCRHCFAWCRGSGKSNVGTSGDHDDSAMKTLRS

• Full Name: POTE ankyrin domain family, member H
• Calculated Molecular Weight: 545 aa, 61 kDa
• Observed Molecular Weight: 61 kDa
• GenBank Accession Number: BC148758
• Gene Symbol: POTEH
• Gene ID (NCBI): 23784
• RRID: AB_2879752
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6S545
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.