POU2AF1 Polyclonal antibody

• 

  WB analysis of mouse lung using 13605-1-AP

  mouse lung tissue was subjected to SDS PAGE followed by western blot with 13605-1-AP (POU2AF1 antibody) at dilution of 1:500 and incubated at room temperature for 1.5 hours.

• 

  WB analysis using 13605-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 13605-1-AP (POU2AF1 antibody) at dilution of 1:5000 and incubated at room temperature for 1.5 hours.

• 

  IF Staining of Raji using 13605-1-AP

  Immunofluorescent analysis of (4% PFA) fixed Raji cells using POU2AF1 antibody (13605-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

POU2AF1 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 13605-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

B-cell-specific coactivator OBF-1, BOB1, BOB-1, OBF1, OCAB

---

Tested Applications

• Positive WB detected in: Raji cells, mouse lung tissue
• Positive IF/ICC detected in: Raji cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13605-1-AP targets POU2AF1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4482

  Product name: Recombinant human POU2AF1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-256 aa of BC032549

  Sequence: MLWQKPTAPEQAPAPARPYQGVRVKEPVKELLRRKRGHASSGAAPAPTAVVLPHQPLATYTTVGPSCLDMEGSVSAVTEEAALCAGWLSQPTPATLQPLAPWTPYTEYVPHEAVSCPYSADMYVQPVCPSYTVVGPSSVLTYASPPLITNVTTRSSATPAVGPPLEGPEHQAPLTYFPWPQPLSTLPTSTLQYQPPAPALPGPQFVQLPISIPEPVLQDMEDPRRAASSLTIDKLLLEEEDSDAYALNHTLSVEGF

• Full Name: POU class 2 associating factor 1
• Calculated Molecular Weight: 256 aa, 27 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC032549
• Gene Symbol: POU2AF1
• Gene ID (NCBI): 5450
• ENSEMBL Gene ID: ENSG00000110777
• RRID: AB_2252633
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q16633
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

POU2AF1, also named as BOB-1 or OCA-B, is a 256 amino acid protein, which belongs to the POU2AF1 family. POU2AF1 is expressed in B-cell specific. POU2AF1 as a transcriptional coactivator that specifically associates with either OCT1 or OCT2. It boosts the OCT1 mediated promoter activity and to a lesser extent, that of OCT2. It has no intrinsic DNA-binding activity. It recognizes the POU domains of OCT1 and OCT2. It is essential for the response of B-cells to antigens and required for the formation of germinal centers.The predicted size of this protein is 27 kDa. Studies have reported that the protein has a multi-band size of 34-35 kDa through siRNA interference experiments (PMID: 17621271). This result is the same as our experiments.