POU2AF1 Monoclonal antibody

• 

  WB analysis of Raji using 66659-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66659-1-Ig (POU2AF1 antibody) at dilution of 1:5000 and incubated at room temperature for 1.5 hours.

• 

  IHC staining of Human tonsillitis using 66659-1-Ig

  Immunohistochemical analysis of paraffin-embedded Human tonsillitis tissue slide using 66659-1-Ig (POU2AF1 antibody) at dilution of 1:1700 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  Affinity and Kinetic Characterization of 66659-1-Ig

  Biolayer interferometry (BLl) kinetic assay of 66659-1-Ig against Human POU2AF1 was performed. The affinity constant is 56.1 nM...

POU2AF1 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 66659-1-Ig

Clone No.3C5A7

Publications(1)

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, ChIP, ELISA

Synonyms

3C5A7, B-cell-specific coactivator OBF-1, BOB1, BOB-1, OBF1

---

Tested Applications

• Positive WB detected in: Raji cells, Ramos cells, Daudi cells
• Positive IHC detected in: Human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:850-1:3400

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• ChIP: See 1 publications below

Product Information

66659-1-Ig targets POU2AF1 in WB, IHC, ChIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23613

  Product name: Recombinant human POU2AF1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-256 aa of BC032549

  Sequence: MLWQKPTAPEQAPAPARPYQGVRVKEPVKELLRRKRGHASSGAAPAPTAVVLPHQPLATYTTVGPSCLDMEGSVSAVTEEAALCAGWLSQPTPATLQPLAPWTPYTEYVPHEAVSCPYSADMYVQPVCPSYTVVGPSSVLTYASPPLITNVTTRSSATPAVGPPLEGPEHQAPLTYFPWPQPLSTLPTSTLQYQPPAPALPGPQFVQLPISIPEPVLQDMEDPRRAASSLTIDKLLLEEEDSDAYALNHTLSVEGF

• Full Name: POU class 2 associating factor 1
• Calculated Molecular Weight: 256 aa, 27 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC032549
• Gene Symbol: POU2AF1
• Gene ID (NCBI): 5450
• ENSEMBL Gene ID: ENSG00000110777
• RRID: AB_2882016
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q16633
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

POU2AF1, also named as BOB-1 or OCA-B, is a 256 amino acid protein, which belongs to the POU2AF1 family. POU2AF1 is expressed in B-cell specific. POU2AF1 as a transcriptional coactivator that specifically associates with either OCT1 or OCT2. It boosts the OCT1 mediated promoter activity and to a lesser extent, that of OCT2. It has no intrinsic DNA-binding activity. It recognizes the POU domains of OCT1 and OCT2. It is essential for the response of B-cells to antigens and required for the formation of germinal centers.The predicted size of this protein is 27 kDa. Studies have reported that the protein has a multi-band size of 34-35 kDa through siRNA interference experiments (PMID: 17621271). This result is the same as our experiments.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	ChIP	Cell; YTHDF2 promotes ATP synthesis and immune evasion in B cell malignancies; Authors - Zhenhua Chen