POU2AF1 Monoclonal antibody, PBS Only (Capture/Detector)

POU2AF1 Monoclonal Antibody for WB, IHC, Cytometric bead array, Indirect ELISA
Cat No. 66659-1-PBS
Clone No.3C5A7

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, Cytometric bead array, Indirect ELISA

3C5A7, B-cell-specific coactivator OBF-1, BOB1, BOB-1, OBF1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66659-1-PBS targets POU2AF1 as part of a matched antibody pair:

MP51058-1: 66659-2-PBS capture and 66659-1-PBS detection (validated in Cytometric bead array)

MP51058-2: 66659-1-PBS capture and 66659-3-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag23613

Product name: Recombinant human POU2AF1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-256 aa of BC032549

Sequence: MLWQKPTAPEQAPAPARPYQGVRVKEPVKELLRRKRGHASSGAAPAPTAVVLPHQPLATYTTVGPSCLDMEGSVSAVTEEAALCAGWLSQPTPATLQPLAPWTPYTEYVPHEAVSCPYSADMYVQPVCPSYTVVGPSSVLTYASPPLITNVTTRSSATPAVGPPLEGPEHQAPLTYFPWPQPLSTLPTSTLQYQPPAPALPGPQFVQLPISIPEPVLQDMEDPRRAASSLTIDKLLLEEEDSDAYALNHTLSVEGF

Predict reactive species
Full Name POU class 2 associating factor 1
Calculated Molecular Weight 256 aa, 27 kDa
Observed Molecular Weight 35 kDa
GenBank Accession NumberBC032549
Gene Symbol POU2AF1
Gene ID (NCBI) 5450
ENSEMBL Gene IDENSG00000110777
RRIDAB_2882016
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ16633
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

POU2AF1, also named as BOB-1 or OCA-B, is a 256 amino acid protein, which belongs to the POU2AF1 family. POU2AF1 is expressed in B-cell specific. POU2AF1 as a transcriptional coactivator that specifically associates with either OCT1 or OCT2. It boosts the OCT1 mediated promoter activity and to a lesser extent, that of OCT2. It has no intrinsic DNA-binding activity. It recognizes the POU domains of OCT1 and OCT2. It is essential for the response of B-cells to antigens and required for the formation of germinal centers.The predicted size of this protein is 27 kDa. Studies have reported that the protein has a multi-band size of 34-35 kDa through siRNA interference experiments (PMID: 17621271). This result is the same as our experiments.

Loading...
||
New chat Able
正在加载,请稍候...