Tested Applications
| Positive WB detected in | HeLa cells, Jurkat cells |
| Positive IHC detected in | mouse brain tissue, human gliomas tissue, human placenta tissue, human skin tissue, human spleen tissue, human ovary tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse brain tissue, human gliomas tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
14596-1-AP targets BRN2 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6131 Product name: Recombinant human POU3F2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 180-443 aa of BC051699 Sequence: SMGASNGGLLYSQPSFTVNGMLGAGGQSAGLHHHGLRDAHDEPHHADHHPHPHSHPHQQPPPPPPPQGPPGHPGAHHDPHSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSSGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGGTLPGAEDVYGGSRDTPPHHGVQTPVQ Predict reactive species |
| Full Name | POU class 3 homeobox 2 |
| Calculated Molecular Weight | 47 kDa |
| Observed Molecular Weight | 47 kDa |
| GenBank Accession Number | BC051699 |
| Gene Symbol | BRN2 |
| Gene ID (NCBI) | 5454 |
| RRID | AB_2167371 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P20265 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
POU3F2 belongs to a large family of transcription factors that bind to the octameric DNA sequence ATGCAAAT. It shares a highly homologous region that referred to as the POU domain. POU3F2 is a Class III POU genes that expressed predominantly in the central nervous system (CNS). It is likely that CNS-specific transcription factors such as these play an important role in mammalian neurogenesis by regulating their diverse patterns of gene expression. POU3F2 is required for maintaining neural cell differetiation and has a role in the production and positioning of neocortical neurons.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for BRN2 antibody 14596-1-AP | Download protocol |
| IHC protocol for BRN2 antibody 14596-1-AP | Download protocol |
| WB protocol for BRN2 antibody 14596-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
BRN2 (POU3F2) Polyclonal antibody (Cat# 14596-1-AP) has 9 citations published in journals including Neuron, Advanced Science, Cell Communication and Signaling, Marine Drugs, Human Molecular Genetics, FEBS Letters, Neuroscience Letters, and eLife. Research fields span neuroscience (neocortical development, neural precursor cells, neuronal migration, cortical malformations), oncology (glioma, prostate cancer), and molecular biology (histone modification, miRNA regulation, O-GlcNAc signaling).
| Species | Application | Title |
|---|---|---|
Neuron HDAC1 and HDAC2 Regulate Intermediate Progenitor Positioning to Safeguard Neocortical Development. | ||
Adv Sci (Weinh) Histone Lactylation-Driven Upregulation of VRK1 Expression Promotes Stemness and Proliferation of Glioma Stem Cells | ||
Adv Sci (Weinh) Enabling Survival of Transplanted Neural Precursor Cells in the Ischemic Brain | ||
Cell Commun Signal Interleukin 27-induced photoreceptor survival is associated with suppression of a novel Muller glia subpopulation. | ||
Mar Drugs The Marine Cembranoid Sarcophine Suppressed the Progression and Recurrence of the Metastatic Castration-Resistant Prostate Cancer via Downregulating EZH2-β-Catenin-Centered Oncogenic Network. | ||
Hum Mol Genet Glutathione S-transferase Pi (Gstp) proteins regulate neuritogenesis in the developing cerebral cortex. |
Reviews
What customers say
The single review for this antibody reports a positive result in immunofluorescence. The user observed positive staining in human cortical neurons derived from iPSCs, using a 1:500 dilution. The product received a 4-star rating, indicating overall satisfaction with its performance in this application.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Mandi (Verified Customer) (09-26-2019) | Positive staining in human cortical neurons derived from iPSCs
|
