CoraLite® Plus 488-conjugated BRN2 Polyclonal antibody

BRN2 Polyclonal Antibody for IF-P
Cat No. CL488-14596

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P

Brain 2, Brn 2, BRN2, Oct 7, OCT7, Octamer binding protein 7, OTF 7, OTF7, POU class 3 homeobox 2, POU3F2, POUF3

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse brain tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-14596 targets BRN2 in IF-P applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag6131

Product name: Recombinant human POU3F2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 180-443 aa of BC051699

Sequence: SMGASNGGLLYSQPSFTVNGMLGAGGQSAGLHHHGLRDAHDEPHHADHHPHPHSHPHQQPPPPPPPQGPPGHPGAHHDPHSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSSGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGGTLPGAEDVYGGSRDTPPHHGVQTPVQ

Predict reactive species
Full Name POU class 3 homeobox 2
Calculated Molecular Weight 47 kDa
Observed Molecular Weight 47 kDa
GenBank Accession NumberBC051699
Gene Symbol BRN2
Gene ID (NCBI) 5454
RRIDAB_3672593
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP20265
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

POU3F2 belongs to a large family of transcription factors that bind to the octameric DNA sequence ATGCAAAT. It shares a highly homologous region that referred to as the POU domain. POU3F2 is a Class III POU genes that expressed predominantly in the central nervous system (CNS). It is likely that CNS-specific transcription factors such as these play an important role in mammalian neurogenesis by regulating their diverse patterns of gene expression. POU3F2 is required for maintaining neural cell differetiation and has a role in the production and positioning of neocortical neurons.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 BRN2 antibody CL488-14596Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...