PP4R4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PP4R4 Polyclonal antibody, PBS Only (20124-1-PBS)

• 

  WB analysis using 20124-1-AP (same clone as 20124-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 20124-1-AP (PP4R4 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20124-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 20124-1-AP (same clone as 20124-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 20124-1-AP (PP4R4 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20124-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 20124-1-AP (same clone as 20124-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 20124-1-AP (PP4R4 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20124-1-PBS in a different storage buffer formulation.

PP4R4 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 20124-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

PPP4R4, KIAA1622, Serine/threonine-protein phosphatase 4 regulatory subunit 4

---

Product Information

20124-1-PBS targets PP4R4 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13868

  Product name: Recombinant human PPP4R4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-98 aa of BC002650

  Sequence: MHPPPPAAAMDFSQNSLFGYMEDLQELTIIERPVRRSLKTPEEIERLTVDEDLSDIERAVYLLSAGQDVQGTSVIANLPFLMRQNPTETLRRVLPKVR

• Full Name: protein phosphatase 4, regulatory subunit 4
• Calculated Molecular Weight: 417 aa, 47 kDa
• Observed Molecular Weight: 90-100 kDa
• GenBank Accession Number: BC002650
• Gene Symbol: PP4R4
• Gene ID (NCBI): 57718
• RRID: AB_3741977
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6NUP7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PP4R4 (also known as SMEK1) is a regulatory subunit of protein phosphatase 4 (PP4), a serine/threonine phosphatase complex crucial for diverse cellular processes. It plays a key role in directing PP4's activity and substrate specificity, particularly in the DNA damage response, cell cycle progression, and centrosome maturation. Studies highlight its involvement in critical pathways such as ATM/ATR signaling for DNA repair and its regulatory function in cell division. Dysregulation of PP4R4 is implicated in genomic instability and is associated with various diseases, including cancer.