PPAP2A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PPAP2A Polyclonal antibody, PBS Only (17967-1-PBS)

• 

  IP experiment of LNCaP using 17967-1-AP (same clone as 17967-1-PBS)

  IP result of anti-PPAP2A (IP:17967-1-AP, 4ug; Detection:17967-1-AP 1:300) with LNCaP cells lysate 2440 ug. This data was developed using the same antibody clone with 17967-1-PBS in a different storage buffer formulation.

PPAP2A Polyclonal Antibody for IP, Indirect ELISA

Cat No. 17967-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IP, Indirect ELISA

Synonyms

---

Product Information

17967-1-PBS targets PPAP2A in IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11615

  Product name: Recombinant human PPAP2A protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 26-284 aa of BC039847

  Sequence: ILTSRHTPFQRGVFCNDESIKYPYKEDTIPYALLGGIIIPFSIIVIILGETLSVYCNLLHSNSFIRNNYIATIYKAIGTFLFGAAASQSLTDIAKYSIGRLRPHFLDVCDPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCMLFVALYLQARMKGDWARLLRPTLQFGLVAVSIYVGLSRVSDYKHHWSDVLTGLIQGALVAILVAVYVSDFFKERTSFKERKEEDSHTTLHETPTTGNHYPSNHQP

• Full Name: phosphatidic acid phosphatase type 2A
• Calculated Molecular Weight: 284 aa, 32 kDa
• Observed Molecular Weight: 30-36 kDa
• GenBank Accession Number: BC039847
• Gene Symbol: PPAP2A
• Gene ID (NCBI): 8611
• RRID: AB_2878473
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O14494
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.