PPAPDC3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PPAPDC3 Polyclonal antibody, PBS Only (20635-1-PBS)

• 

  WB analysis of mouse skeletal muscle using 20635-1-AP (same clone as 20635-1-PBS)

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 20635-1-AP (PPAPDC3 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20635-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse skeletal muscle using 20635-1-AP (same clone as 20635-1-PBS)

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 20635-1-AP (PPAPDC3 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20635-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse skeletal muscle using 20635-1-AP (same clone as 20635-1-PBS)

  IP result of anti-PPAPDC3 (IP:20635-1-AP, 4ug; Detection:20635-1-AP 1:800) with mouse skeletal muscle tissue lysate 4000ug. This data was developed using the same antibody clone with 20635-1-PBS in a different storage buffer formulation.

PPAPDC3 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 20635-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, Indirect ELISA

Synonyms

---

Product Information

20635-1-PBS targets PPAPDC3 in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14676

  Product name: Recombinant human PPAPDC3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-65 aa of BC006362

  Sequence: MPASQSRARARDRNNVLNRAEFLSLNQPPKGGPEPRSSGRKASGPSAQPPPAGDGARERRQSQQL

• Full Name: phosphatidic acid phosphatase type 2 domain containing 3
• Calculated Molecular Weight: 271 aa, 29 kDa
• Observed Molecular Weight: 29 kDa
• GenBank Accession Number: BC006362
• Gene Symbol: PPAPDC3
• Gene ID (NCBI): 84814
• RRID: AB_10696180
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NBV4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PPAPDC3(Phosphatidic acid phosphatase type 2 domain-containing protein 3) is also named as C9orf67 and belongs to the PA-phosphatase related phosphoesterase family. It plays a role as negative regulator of myoblast differentiation, in part through effects on MTOR signaling.