• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated PPARA Monoclonal antibody

PPARA Monoclonal Antibody for
Cat No. CL488-66826
Clone No.1G1E10

Host / Isotype

Mouse / IgG1

Reactivity

human, rat

Applications

PPAR alpha, PPAR, Peroxisome proliferator-activated receptor alpha, NR1C1, hPPAR

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

CL488-66826 targets PPARA in applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7896

Product name: Recombinant human PPARA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-258 aa of BC000052

Sequence: MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSCPGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACEGCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSEKAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPVGVCGCSGFSWQHGTSVVEDD

Predict reactive species
Full Name peroxisome proliferator-activated receptor alpha
Calculated Molecular Weight 52 kDa
Observed Molecular Weight 53 kDa
GenBank Accession NumberBC000052
Gene Symbol PPARA
Gene ID (NCBI) 5465
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ07869
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Peroxisome proliferator-activated receptor alpha (PPARA) is a ligand-activated transcription factor that belongs to the PPAR nuclear receptor superfamily. PPARA is essential in the modulation of lipid transport and metabolism, mainly through activating mitochondrial and peroxisomal fatty acid β-oxidation pathways. In addition, PPARA seems to decrease inflammation mainly through direct interaction with NF-κB, causing inhibition of its signaling pathway or reducing the activated levels of NF-κB and subsequent inflammation. Furthermore, PPARA was implicated in the attenuation of oxidative stress in alcoholic liver disease when treated with polyenephosphatidylcholine through downregulation of ROS-generating enzymes such as ethanol-inducible cytochrome P450 2E1 (CYP2E1), acyl-CoA oxidase, and NADPH oxidase. PPARA exists two isoforms and molecular weight of PPARA isoforms are 52 kDa and 22 kDa. The ability of a retinoid X receptor (RXR) to heterodimerize with many nuclear receptors, including LXR, PPAR, NGF1B and RAR, underscores its pivotal role within the nuclear receptor superfamily. Among these heterodimers, PPAR:RXR is considered an important signalling mediator of both PPAR ligands, such as fatty acids, and 9-cis retinoic acid (9-cis RA), an RXR ligand. (PMID: 15103326 ). PPARA can form Heterodimer with RXRA and molecular weight of Heterodimer is about 110 kDa.

Loading...
||
New chat

Able

正在加载,请稍候...