PPARGC1B Polyclonal antibody, PBS Only

• 

  WB analysis using 22378-1-AP (same clone as 22378-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 22378-1-AP (PPARGC1B antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22378-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse liver using 22378-1-AP (same clone as 22378-1-PBS)

  IP result of anti-PPARGC1B (IP:22378-1-AP, 4ug; Detection:22378-1-AP 1:300) with mouse liver tissue lysate 4000ug. This data was developed using the same antibody clone with 22378-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

PPARGC1B Polyclonal Antibody for WB, Indirect ELISA

Cat No. 22378-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

22378-1-PBS targets PPARGC1B in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17566

  Product name: Recombinant human PPARGC1B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-350 aa of BC132971

  Sequence: MAGNDCGALLDEELSSFFLNYLADTQGGGSGEEQLYADFPELDLSQLDASDFDSATCFGELQWCPENSETEPNQYSPDDSELFQIDSENEALLAELTKTLDDIPEDDVGLAAFPALDGGDALSCTSASPAPSSAPPSPAPEKPSAPAPEVDELSLLQKLLLATSYPTSSSDTQKEGTAWRQAGLRSKSQRPCVKADSTQDKKAPMMQSQSRSCTELHKHLTSAQCCLQDRGLQPPCLQSPRLPAKEDKEPGEDCPSPQPAPASPRDSLALGRADPGAPVSQEDMQAMVQLIRYMHTYCLPQRKLPPQTPEPLPKACSNPSQQVRSRPWSRHHSKASWAEFSILRELLAQD

• Full Name: peroxisome proliferator-activated receptor gamma, coactivator 1 beta
• Calculated Molecular Weight: 1023 aa, 113 kDa
• Observed Molecular Weight: 100-110 kDa
• GenBank Accession Number: BC132971
• Gene Symbol: PPARGC1B
• Gene ID (NCBI): 133522
• RRID: AB_2879093
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86YN6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.