• Featured Product
  • KD/KO Validated

PPFIA3 Recombinant monoclonal antibody, PBS Only (Capture)

PPFIA3 Uni-rAb® Recombinant Antibody for WB, FC (Intra), IP, Cytometric bead array, Indirect ELISA
Cat No. 83142-4-PBS
Clone No.230459F6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, FC (Intra), IP, Cytometric bead array, Indirect ELISA

230459F6, KIAA0654, Liprin-alpha-3, Protein tyrosine phosphatase receptor type f polypeptide-interacting protein alpha-3, PTPRF-interacting protein alpha-3

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83142-4-PBS targets PPFIA3 as part of a matched antibody pair:

MP00170-2: 83142-4-PBS capture and 83142-3-PBS detection (validated in Cytometric bead array)

MP00170-3: 83142-4-PBS capture and 83142-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1971

Product name: Recombinant human PPFIA3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-277 aa of BC021255

Sequence: APASSRTSTGNVWMTHEEMESLTATTKPILAYGDMNHEWVGNDWLPSLGLPQYRSYFMESLVDARMLDHLNKKELRGQLKMVDSFHRVSLHYGIMCLKRLNYDRKDLERRREESQTQIRDVMVWSNERVMGWVSGLGLKEFATNLTESGVHGALLALDETFDYSDLALLLQIPTQNAQARQLLEKEFSNLISLGTDRRLDEDSAKSFSRSPSWRKMFREKDLRGVTPDSAEMLPPNFRSAAAGALGSPGLPLRKLQPEGQTSGSSRADGVSVRTYSC

Predict reactive species
Full Name protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 3
Calculated Molecular Weight 1194 aa, 133 kDa
Observed Molecular Weight 140 kDa
GenBank Accession NumberBC021255
Gene Symbol PPFIA3
Gene ID (NCBI) 8541
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO75145
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

PPFIA3, also named as KIAA0654, belongs to the liprin family and Liprin-alpha subfamily. PPFIA3 may regulate the disassembly of focal adhesions. It may localize receptor-like tyrosine phosphatases type 2A at specific sites on the plasma membrane, possibly regulating their interaction with the extracellular environment and their association with substrates. PPFIA3 exhibites more than 5 fold accumulations in the monoribosome fraction. PPFIA3 is decreased at the protein level by the miR-99 family but not in the luciferase reporter with the 3'UTR of PPFIA3. (PMID:21212412)

Loading...
||
New chat Able
正在加载,请稍候...