PPFIA3 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  WB analysis using 83142-4-RR (same clone as 83142-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83142-4-RR (PPFIA3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83142-4-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 83142-4-RR (same clone as 83142-4-PBS)

  WB result of PPFIA3 antibody (83142-4-RR; 1:20000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PPFIA3 transfected HEK-293 cells. This data was developed using the same antibody clone with 83142-4-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 83142-4-RR (same clone as 83142-4-PBS)

  IP result of anti-PPFIA3 (IP:83142-4-RR, 4ug; Detection:83142-4-RR 1:4000) with mouse brain tissue lysate 2100 ug. This data was developed using the same antibody clone with 83142-4-PBS in a different storage buffer formulation.

• 

  FC experiment of HEK-293 using 83142-4-RR (same clone as 83142-4-PBS)

  1x10^6 HEK-293 cells were intracellularly stained with 0.25 ug PPFIA3 Recombinant antibody (83142-4-RR, Clone:230459F6) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 83142-4-PBS in a different storage buffer formulation.

• 

  FC experiment of U-251 using 83142-4-RR (same clone as 83142-4-PBS)

  1x10^6 U-251 cells were intracellularly stained with 0.25 ug PPFIA3 Recombinant antibody (83142-4-RR, Clone:230459F6) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 83142-4-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP00170-2

  Cytometric bead array standard curve of MP00170-2, PPFIA3 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 83142-4-PBS. Detection antibody: 83142-3-PBS. Standard: Ag1971. Range: 1.25-20 ng/mL.

• 

  Cytometric bead array standard curve of MP00170-3

  Cytometric bead array standard curve of MP00170-3, PPFIA3 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 83142-4-PBS. Detection antibody: 83142-2-PBS. Standard: Ag1971. Range: 1.25-20 ng/mL.

• 

  Affinity and Kinetic Characterization of 83142-4-RR

  Biolayer interferometry (BLl) kinetic assays of 83142-4-RR against Human PPFIA3 were performed. The affinity constant is 0.131 nM.

• Featured Product
• KD/KO Validated

PPFIA3 Uni-rAb^® Recombinant Antibody for WB, FC (Intra), IP, Cytometric bead array, Indirect ELISA

Cat No. 83142-4-PBS

Clone No.230459F6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, FC (Intra), IP, Cytometric bead array, Indirect ELISA

Synonyms

230459F6, KIAA0654, Liprin-alpha-3, Protein tyrosine phosphatase receptor type f polypeptide-interacting protein alpha-3, PTPRF-interacting protein alpha-3

---

Product Information

83142-4-PBS targets PPFIA3 as part of a matched antibody pair:

MP00170-2: 83142-4-PBS capture and 83142-3-PBS detection (validated in Cytometric bead array)

MP00170-3: 83142-4-PBS capture and 83142-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1971

  Product name: Recombinant human PPFIA3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-277 aa of BC021255

  Sequence: APASSRTSTGNVWMTHEEMESLTATTKPILAYGDMNHEWVGNDWLPSLGLPQYRSYFMESLVDARMLDHLNKKELRGQLKMVDSFHRVSLHYGIMCLKRLNYDRKDLERRREESQTQIRDVMVWSNERVMGWVSGLGLKEFATNLTESGVHGALLALDETFDYSDLALLLQIPTQNAQARQLLEKEFSNLISLGTDRRLDEDSAKSFSRSPSWRKMFREKDLRGVTPDSAEMLPPNFRSAAAGALGSPGLPLRKLQPEGQTSGSSRADGVSVRTYSC

• Full Name: protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 3
• Calculated Molecular Weight: 1194 aa, 133 kDa
• Observed Molecular Weight: 140 kDa
• GenBank Accession Number: BC021255
• Gene Symbol: PPFIA3
• Gene ID (NCBI): 8541
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O75145
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PPFIA3, also named as KIAA0654, belongs to the liprin family and Liprin-alpha subfamily. PPFIA3 may regulate the disassembly of focal adhesions. It may localize receptor-like tyrosine phosphatases type 2A at specific sites on the plasma membrane, possibly regulating their interaction with the extracellular environment and their association with substrates. PPFIA3 exhibites more than 5 fold accumulations in the monoribosome fraction. PPFIA3 is decreased at the protein level by the miR-99 family but not in the luciferase reporter with the 3'UTR of PPFIA3. (PMID:21212412)