• Featured Product
  • KD/KO Validated

PPFIA3 Recombinant monoclonal antibody

PPFIA3 Uni-rAb® Recombinant Antibody for WB, FC (Intra), IP, ELISA
Cat No. 83142-4-RR
Clone No.230459F6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, FC (Intra), IP, ELISA

230459F6, KIAA0654, Liprin-alpha-3, Protein tyrosine phosphatase receptor type f polypeptide-interacting protein alpha-3, PTPRF-interacting protein alpha-3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inSH-SY5Y cells, HEK-293 cells, mouse brain tissue, rat brain tissue
Positive IP detected inmouse brain tissue
Positive FC (Intra) detected inU-251 cells, HEK-293 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83142-4-RR targets PPFIA3 in WB, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1971

Product name: Recombinant human PPFIA3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-277 aa of BC021255

Sequence: APASSRTSTGNVWMTHEEMESLTATTKPILAYGDMNHEWVGNDWLPSLGLPQYRSYFMESLVDARMLDHLNKKELRGQLKMVDSFHRVSLHYGIMCLKRLNYDRKDLERRREESQTQIRDVMVWSNERVMGWVSGLGLKEFATNLTESGVHGALLALDETFDYSDLALLLQIPTQNAQARQLLEKEFSNLISLGTDRRLDEDSAKSFSRSPSWRKMFREKDLRGVTPDSAEMLPPNFRSAAAGALGSPGLPLRKLQPEGQTSGSSRADGVSVRTYSC

Predict reactive species
Full Name protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 3
Calculated Molecular Weight 1194 aa, 133 kDa
Observed Molecular Weight 140 kDa
GenBank Accession NumberBC021255
Gene Symbol PPFIA3
Gene ID (NCBI) 8541
RRIDAB_3670843
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO75145
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PPFIA3, also named as KIAA0654, belongs to the liprin family and Liprin-alpha subfamily. PPFIA3 may regulate the disassembly of focal adhesions. It may localize receptor-like tyrosine phosphatases type 2A at specific sites on the plasma membrane, possibly regulating their interaction with the extracellular environment and their association with substrates. PPFIA3 exhibites more than 5 fold accumulations in the monoribosome fraction. PPFIA3 is decreased at the protein level by the miR-99 family but not in the luciferase reporter with the 3'UTR of PPFIA3. (PMID:21212412)

Protocols

Product Specific Protocols
IP protocol for PPFIA3 antibody 83142-4-RRDownload protocol
WB protocol for PPFIA3 antibody 83142-4-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...