Home
Products
Primary Antibodies
PPFIA4 Polyclonal antibody, PBS Only (25295-1-PBS)

Filter: AllIHC

IHC staining of mouse brain using 25295-1-AP (same clone as 25295-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 25295-1-AP (PPFIA4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25295-1-PBS in a different storage buffer formulation.
IHC staining of mouse brain using 25295-1-AP (same clone as 25295-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 25295-1-AP (PPFIA4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25295-1-PBS in a different storage buffer formulation.
IHC staining of rat brain using 25295-1-AP (same clone as 25295-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 25295-1-AP (PPFIA4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25295-1-PBS in a different storage buffer formulation.
IHC staining of rat brain using 25295-1-AP (same clone as 25295-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 25295-1-AP (PPFIA4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25295-1-PBS in a different storage buffer formulation.

PPFIA4 Polyclonal antibody, PBS Only

Name: PPFIA4 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 25295-1-PBS

PPFIA4 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 25295-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

25295-1-PBS targets PPFIA4 in IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag18130 Product name: Recombinant human PPFIA4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-78 aa of BC132925 Sequence: MGSAADVRFSLGTTTHAPPGVHRRYSALREESAKDWETSPLPGMLAPAAGPAFDSDPEISDVDEDEPGGLVGSADVVS Predict reactive species
Full Name	protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 4
Calculated Molecular Weight	701 aa, 78 kDa
GenBank Accession Number	BC132925
Gene Symbol	PPFIA4
Gene ID (NCBI)	8497
RRID	AB_3085783
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	O75335
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Protein tyrosine phosphatase receptor type F polypeptide interacting protein alpha 4 (PPFIA4), also named as Liprin alpha 4, belongs to the liprin family and Liprin-alpha subfamily. PPFIA4 has been reported as a new potential therapeutic target for refractory pancreatic cancer, small cell lung cancer, and clear cell renal cell cancer (PMID: 35382861). As a glycolysis-related oncogene, PPFIA4 is also a potential biomarker of colon cancer (PMID: 34094943).