PPM1B Polyclonal antibody

PPM1B Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 13193-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, ELISA, Cell treatment

Protein phosphatase 1B, PP2C-beta, PP2CB, PP2C beta, EC:3.1.3.16

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, MCF-7 cells
Positive IHC detected inhuman breast cancer tissue, human skeletal muscle tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13193-1-AP targets PPM1B in WB, IHC, IF/ICC, IP, ELISA, Cell treatment applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3871

Product name: Recombinant human PPM1B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-192 aa of BC012002

Sequence: MSIVLVCFSNAPKVSDEAVKKDSELDKHLESRVEEIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRNVIEAVYSRLNPHRESDGASDEAEESGSQGKLVEALRQMRINHRGNYRQLLEEMLTSYRLAKVEGEESPAEPAATATSSNSDAGNPVTMQESHTESESGLAELDSSNEDAGTKMSGEKI

Predict reactive species
Full Name protein phosphatase 1B (formerly 2C), magnesium-dependent, beta isoform
Calculated Molecular Weight 479 aa, 53 kDa
Observed Molecular Weight 36, 53 kDa
GenBank Accession NumberBC012002
Gene Symbol PPM1B
Gene ID (NCBI) 5495
RRIDAB_10644118
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO75688
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PPM1B is a member of the metal-dependent serine/threonine protein phosphatase (PPM) family with important regulatory functions in cellular signalling pathways(PMID: 18066953). PPM1B is also an important negative regulator of several stress signalling pathways and has been shown to negatively regulate the stress-activated p38 and JNK pathways by directly dephosphorylating upstream signalling proteins(PMID: 9824284). Moreover, PPM1B has also been shown to prevent cell death by negatively regulating necrotic cell death in a RIP3 dephosphorylation-dependent manner.(PMID: 25751141) PPM1B can be detected as the WM of 36-55 kDa.

Protocols

Product Specific Protocols
IF protocol for PPM1B antibody 13193-1-APDownload protocol
IHC protocol for PPM1B antibody 13193-1-APDownload protocol
WB protocol for PPM1B antibody 13193-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIP

Nat Commun

USP9X regulates centrosome duplication and promotes breast carcinogenesis.

Authors - Xin Li
mouseIP,IF,Cell treatment

Cell Rep

Blocking AMPK β1 myristoylation enhances AMPK activity and protects mice from high-fat diet-induced obesity and hepatic steatosis

Authors - Katyayanee Neopane
human

Biochim Biophys Acta Mol Cell Res

TXLNA enhances TBK1 phosphorylation by suppressing PPM1B recruitment

Authors - Xiao Tian
mouse

Front Pharmacol

Initial Characterization of Stressed Transgenic Mice With Cardiomyocyte-Specific Overexpression of Protein Phosphatase 2C.

Authors - Paula Bollmann
humanIF

Exp Cell Res

RBM10 regulates the tumorigenic potential of human cancer cells by modulating PPM1B and YBX1 activities

Authors - Yueyang Li
human

Front Pharmacol

Icariin promotes functional recovery in rats after spinal cord injury by inhibiting YAP and regulating PPM1B ubiquitination to inhibiting the activation of reactive astrocytes

Authors - Sa Feng
Loading...
||
New chat

Able

正在加载,请稍候...