PPM1D Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PPM1D Polyclonal antibody (26532-1-AP)

PPM1D Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 26532-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, Rat

Applications

WB, IF/ICC, ELISA

Synonyms

PP2C DELTA, PPM1D, Protein phosphatase 1D, WIP1

• 

  WB analysis of MCF-7 using 26532-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 26532-1-AP (PPM1D antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse lung using 26532-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 26532-1-AP (PPM1D Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat testis using 26532-1-AP

  rat testis tissue were subjected to SDS PAGE followed by western blot with 26532-1-AP (PPM1D Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 26532-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 26532-1-AP (PPM1D antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of MCF-7 using 26532-1-AP

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using 26532-1-AP (PPM1D antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of MCF-7 using 26532-1-AP

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using 26532-1-AP (PPM1D antibody) at dilution of 1:50 and Alexa Fluor 488-Conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: MCF-7 cells, mouse lung tissue, rat testis tissue
• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26532-1-AP targets PPM1D in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, Rat samples.

• Tested Reactivity: human, mouse, Rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24751

  Product name: Recombinant human PPM1D protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 254-423 aa of BC060877

  Sequence: NGPVRRSTVIDQIPFLAVARALGDLWSYDFFSGEFVVSPEPDTSVHTLDPQKHKYIILGSDGLWNMIPQQDAISMCQDQEEKKYLMGEHGQSCAKMLVNRALGRWRQRMLRADNTSAIVICISPEVDNQGNFTNEDELYLNLTDSPSYNSQETCVMTPSPCSTPPVKSLE

• Full Name: protein phosphatase 1D magnesium-dependent, delta isoform
• Observed Molecular Weight: 67 kDa
• GenBank Accession Number: BC060877
• Gene Symbol: PPM1D
• Gene ID (NCBI): 8493
• RRID: AB_2880544
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15297
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PPM1D (also known as PP2Cd and WIP1) is a member of the PPM family, which is characterized by Mg2+/Mn2+-dependent activity and relative insensitivity to okadaic acid. The PPM1D gene is aberrantly amplified in a range of common cancers and encodes a protein phosphatase that is a potential therapeutic target (PMID: 17700519). This antibody can be detected two bands of 47 and 67 Kda.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Radiat Res; Temporal Dynamic Regulation of Autophagy and Senescence Induction in Response to Radiation Exposure; Authors - Miho Noguchi