PPP1CA Polyclonal antibody

• 

  WB analysis using 28617-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28617-1-AP (PPP1CA antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 28617-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 28617-1-AP (PPP1CA antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 28617-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 28617-1-AP (PPP1CA antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

PPP1CA Polyclonal Antibody for WB, IHC, ELISA

Cat No. 28617-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

Human and More (1)

Applications

WB, IHC, ELISA

Synonyms

PP 1A, PPP1A, PPP1CA

---

Tested Applications

• Positive WB detected in: HeLa cells, LNCaP cells
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below

Product Information

28617-1-AP targets PPP1CA in WB, IHC, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28451

  Product name: Recombinant human PPP1CA protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 140-330 aa of BC001888

  Sequence: CKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK

• Full Name: protein phosphatase 1, catalytic subunit, alpha isoform
• Calculated Molecular Weight: 330 aa, 38 kDa
• Observed Molecular Weight: 37 kDa
• GenBank Accession Number: BC001888
• Gene Symbol: PPP1CA
• Gene ID (NCBI): 5499
• RRID: AB_2918182
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P62136
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Cancer; Phase separation of phospho-HDAC6 drives aberrant chromatin architecture in triple-negative breast cancer; Authors - Bing Lu ; KD Validated