PPP1CA Monoclonal antibody, PBS Only

• 

  WB analysis using 67070-1-Ig (same clone as 67070-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67070-1-Ig (PPP1CA antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67070-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67070-1-Ig (same clone as 67070-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67070-1-Ig (PPP1CA antibody) at dilution of 1:2600 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Alpha Tubulin Monoclonal antibody (HRP-66031) as loading control. This data was developed using the same antibody clone with 67070-1-PBS in a different storage buffer formulation.

• 

  WB analysis of zebrafish using 67070-1-Ig (same clone as 67070-1-PBS)

  zebrafish tissue were subjected to SDS PAGE followed by western blot with 67070-1-Ig (PPP1CA antibody) at dilution of 1:2600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67070-1-PBS in a different storage buffer formulation.

• 

  WB analysis of fetal human brain using 67070-1-Ig (same clone as 67070-1-PBS)

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 67070-1-Ig (PPP1CA antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67070-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig brain using 67070-1-Ig (same clone as 67070-1-PBS)

  pig brain tissue were subjected to SDS PAGE followed by western blot with 67070-1-Ig (PPP1CA antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67070-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

PPP1CA Monoclonal Antibody for WB, ELISA

Cat No. 67070-1-PBS

Clone No.1C10A2

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit, zebrafish

Applications

WB, ELISA

Synonyms

EC:3.1.3.16, PP 1A, PP-1A, PPP1A, Serine/threonine-protein phosphatase PP1-alpha catalytic subunit

---

Product Information

67070-1-PBS targets PPP1CA in WB, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit, zebrafish samples.

• Tested Reactivity: human, mouse, rat, pig, rabbit, zebrafish
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28451

  Product name: Recombinant human PPP1CA protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 140-330 aa of BC001888

  Sequence: CKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK

• Full Name: protein phosphatase 1, catalytic subunit, alpha isoform
• Calculated Molecular Weight: 330 aa, 38 kDa
• Observed Molecular Weight: 37 kDa
• GenBank Accession Number: BC001888
• Gene Symbol: PPP1CA
• Gene ID (NCBI): 5499
• RRID: AB_2882379
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P62136
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.