PPP1CB Recombinant monoclonal antibody

• 

  WB analysis using 84938-5-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 84938-5-RR (PPP1CB antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 84938-5-RR

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 84938-5-RR (PPP1CB antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 84938-5-RR

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 84938-5-RR (PPP1CB antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A549 using 84938-5-RR

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using PPP1CB antibody (84938-5-RR, Clone: 242547H7 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  IF Staining of MCF-7 using 84938-5-RR

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using PPP1CB antibody (84938-5-RR, Clone: 242547H7 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  FC experiment of Jurkat using 84938-5-RR

  1x10^6 Jurkat cells were intracellularly stained with 0.25 ug PPP1CB Recombinant antibody (84938-5-RR, Clone:242547H7) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• 

  Affinity and Kinetic Characterization of 84938-5-RR

  Biolayer interferometry (BLl) kinetic assays of 84938-5-RR against Human PPP1CB were performed. The affinity constant is 2.44 nM.

PPP1CB Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 84938-5-RR

Clone No.242547H7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

242547H7, EC:3.1.3.16, PP 1B, PP1 Beta, PP-1B

---

Tested Applications

• Positive WB detected in: A431 cells, HeLa cells, HepG2 cells, MCF- cells, Jurkat cells, mouse brain tissue, rat brain tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: MCF-7 cells, A549 cells
• Positive FC (Intra) detected in: Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84938-5-RR targets PPP1CB in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0183

  Product name: Recombinant human PPP1CB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-183 aa of BC002697

  Sequence: MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSME

• Full Name: protein phosphatase 1, catalytic subunit, beta isoform
• Calculated Molecular Weight: 37 kDa
• Observed Molecular Weight: 35-37 kDa
• GenBank Accession Number: BC002697
• Gene Symbol: PPP1CB
• Gene ID (NCBI): 5500
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P62140
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Protein phosphatase 1 (PP1) is the main eukaryotic protein serine/threonine phosphatase that regulates an enormous variety of cellular processes including protein-protein interactions, gene transcription, cell-cycle progression and apoptosis. It is a trimeric complex composed of a regulatory subunit, a variable subunit and a catalytic subunit. The catalytic subunit of PP1 (PP1c) can interact with amount of regulatory subunits in vivo that target it to particular subcellular locations and regulate its activity towards specific substrates.