PPP1R10 Polyclonal antibody

• 

  WB analysis of HepG2 using 24450-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 24450-1-AP (PPP1R10 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HepG2 using 24450-1-AP

  Immunofluorescent analysis of (10% Formaldehyde) fixed HepG2 cells using 24450-1-AP (PPP1R10 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

PPP1R10 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 24450-1-AP

Publications(2)

Reviews (3)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, IP, ELISA

Synonyms

CAT53, FB19, MHC class I region proline-rich protein CAT53, p99, PNUTS

---

Tested Applications

• Positive WB detected in: HepG2 cells
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IP: See 1 publications below

Product Information

24450-1-AP targets PPP1R10 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20091

  Product name: Recombinant human PPP1R10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-318 aa of BC150310

  Sequence: MGSGPIDPKELLKGLDSFLNRDGEVKSVDGISKIFSLMKEARKMVSRCTYLNILLQTRSPEILVKFIDVGGYKLLNNWLTYSKTTNNIPLLQQILLTLQHLPLTVDHLKQNNTAKLVKQLSKSSEDEELRKLASVLVSDWMAVIRSQSSTQPAEKDKKKRKDEGKSRTTLPERPLTEVKAETRAEEAPEKKREKPKSLRTTAPSHAKFRSTGLELETPSLVPVKKNASTVVVSDKYNLKPIPLKRQSNVAAPGDATPPAEKKYKPLNTTPNATKEIKVKIIPPQPMEGLGFLDALNSAPVPGIKIKKKKKVLSPTAAK

• Full Name: protein phosphatase 1, regulatory (inhibitor) subunit 10
• Calculated Molecular Weight: 940 aa, 99 kDa
• Observed Molecular Weight: 99-110 kDa
• GenBank Accession Number: BC150310
• Gene Symbol: PPP1R10
• Gene ID (NCBI): 5514
• RRID: AB_2879554
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96QC0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Nat Cell Biol; A regulated PNUTS mRNA to lncRNA splice switch mediates EMT and tumour progression.; Authors - Simon Grelet
human	WB,IP	J Exp Clin Cancer Res; Radiotherapy resistance driven by Asparagine endopeptidase through ATR pathway modulation in breast cancer; Authors - Macarena Morillo-Huesca

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Lucas (Verified Customer) (04-15-2025)

Works ok in Western Blot, it seems to depend on the secondary antibody used.

• Applications: Western Blot

FH

Roy (Verified Customer) (06-15-2024)

Perfect to detect PNUTS by WB (1/1000, Overnight incubation at 4°C) and by IF (1/250) in HeLa cells

• Applications: Western Blot, Immunofluorescence
• Primary Antibody Dilution: 1/1000
• Cell Tissue Type: HeLa

FH

Fabienne (Verified Customer) (06-11-2024)

Works well in western blot

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: HeLa cell line