PPP1R10 Recombinant monoclonal antibody

• 

  WB analysis using 86888-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86888-1-RR (PPP1R10 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HepG2 using 86888-1-RR

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using PPP1R10 antibody (86888-1-RR, Clone: 251508G3 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

PPP1R10 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 86888-1-RR

Clone No.251508G3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

CAT53, FB19, MHC class I region proline-rich protein CAT53, p99, PNUTS

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86888-1-RR targets PPP1R10 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag20091

  Product name: Recombinant human PPP1R10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-318 aa of BC150310

  Sequence: MGSGPIDPKELLKGLDSFLNRDGEVKSVDGISKIFSLMKEARKMVSRCTYLNILLQTRSPEILVKFIDVGGYKLLNNWLTYSKTTNNIPLLQQILLTLQHLPLTVDHLKQNNTAKLVKQLSKSSEDEELRKLASVLVSDWMAVIRSQSSTQPAEKDKKKRKDEGKSRTTLPERPLTEVKAETRAEEAPEKKREKPKSLRTTAPSHAKFRSTGLELETPSLVPVKKNASTVVVSDKYNLKPIPLKRQSNVAAPGDATPPAEKKYKPLNTTPNATKEIKVKIIPPQPMEGLGFLDALNSAPVPGIKIKKKKKVLSPTAAK

• Full Name: protein phosphatase 1, regulatory (inhibitor) subunit 10
• Calculated Molecular Weight: 940 aa, 99 kDa
• Observed Molecular Weight: 99-110 kDa
• GenBank Accession Number: BC150310
• Gene Symbol: PPP1R10
• Gene ID (NCBI): 5514
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96QC0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.