PPP1R14B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PPP1R14B Polyclonal antibody, PBS Only (18476-1-PBS)

• 

  WB analysis of MCF-7 using 18476-1-AP (same clone as 18476-1-PBS)

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 18476-1-AP (PPP1R14B antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18476-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 18476-1-AP (same clone as 18476-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 18476-1-AP (PPP1R14B antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18476-1-PBS in a different storage buffer formulation.

• 

  WB analysis of U2OS using 18476-1-AP

  U2OS cells were subjected to SDS PAGE followed by western blot with 18476-1-AP (PPP1R14B antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A549 using 18476-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 18476-1-AP (PPP1R14B antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 18476-1-AP (same clone as 18476-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 18476-1-AP (PPP1R14B antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18476-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human heart using 18476-1-AP (same clone as 18476-1-PBS)

  human heart tissue were subjected to SDS PAGE followed by western blot with 18476-1-AP (PPP1R14B antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18476-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse skeletal muscle using 18476-1-AP (same clone as 18476-1-PBS)

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 18476-1-AP (PPP1R14B antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18476-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 18476-1-AP (same clone as 18476-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using PPP1R14B antibody (18476-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 18476-1-PBS in a different storage buffer formulation.

PPP1R14B Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 18476-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

SOM172, PNG, PLCB3N, Phospholipase C-beta-3 neighbouring gene protein, PHI 1

---

Product Information

18476-1-PBS targets PPP1R14B in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13373

  Product name: Recombinant human PPP1R14B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-147 aa of BC014522

  Sequence: MADSGTAGGAALAAPAPGPGSGGPGPRVYFQSPPGAAGEGPGGADDEGPVRRQGKVTVKYDRKELRKRLNLEEWILEQLTRLYDCQEEEIPELEIDVDELLDMESDDARAARVKELLVDCYKPTEAFISGLLDKIRGMQKLSTPQKK

• Full Name: protein phosphatase 1, regulatory (inhibitor) subunit 14B
• Calculated Molecular Weight: 147 aa, 16 kDa
• Observed Molecular Weight: 23 kDa
• GenBank Accession Number: BC014522
• Gene Symbol: PPP1R14B
• Gene ID (NCBI): 26472
• RRID: AB_10598019
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96C90
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.