PPP1R3B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PPP1R3B Polyclonal antibody, PBS Only (14190-1-PBS)

• 

  WB analysis of mouse liver using 14190-1-AP (same clone as 14190-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 14190-1-AP (PPP1R3B antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14190-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 14190-1-AP (same clone as 14190-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer slide using 14190-1-AP (PPP1R3B antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14190-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 14190-1-AP (same clone as 14190-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer slide using 14190-1-AP (PPP1R3B antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14190-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

PPP1R3B Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 14190-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

Hepatic glycogen-targeting protein phosphatase 1 regulatory subunit GL, PP1 subunit R4, PPP1R4, PTG

---

Product Information

14190-1-PBS targets PPP1R3B in WB, IHC, Indirect ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5521

  Product name: Recombinant human PPP1R3B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-285 aa of BC043388

  Sequence: MMAVDIEYRYNCMAPSLRQERFAFKISPKPSKPLRPCIQLSSKNEASGMVAPAVQEKKVKKRVSFADNQGLALTMVKVFSEFDDPLDMPFNITELLDNIVSLTTAESESFVLDFSQPSADYLDFRNRLQADHVCLENCVLKDKAIAGTVKVQNLAFEKTVKIRMTFDTWKSYTDFPCQYVKDTYAGSDRDTFSFDISLPEKIQSYERMEFAVYYECNGQTYWDSNRGKNYRIIRAELKSTQGMTKPHSGPDLGISFDQFGSPRCSYGLFPEWPSYLGYEKLGPYY

• Full Name: protein phosphatase 1, regulatory (inhibitor) subunit 3B
• Calculated Molecular Weight: 33 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC043388
• Gene Symbol: PPP1R3B
• Gene ID (NCBI): 79660
• RRID: AB_2878026
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86XI6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.