PPP2CA Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• PPP2CA Recombinant monoclonal antibody (84155-2-RR)

• 

  WB analysis of HeLa using 84155-2-RR

  HeLa cells were subjected to SDS PAGE followed by western blot with 84155-2-RR (PPP2CA antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon using 84155-2-RR

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 84155-2-RR (PPP2CA antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 84155-2-RR

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 84155-2-RR (PPP2CA antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  Affinity and Kinetic Characterization of 84155-2-RR

  Biolayer interferometry (BLl) kinetic assays of 84155-2-RR against Human PPP2CA were performed. The affinity constant is 11.6 nM.

PPP2CA Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 84155-2-RR

Clone No.241112A6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, ELISA

Synonyms

241112A6, EC:3.1.3.16, PP2A alpha, PP2A-alpha, PP2Ac

---

Tested Applications

• Positive WB detected in: HeLa cells, Jurkat cells, MCF-7 cells, mouse brain tissue, pig brain tissue, rat brain tissue
• Positive IHC detected in: human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84155-2-RR targets PPP2CA in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag4294

  Product name: Recombinant human PPP2CA protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-309 aa of BC031696

  Sequence: MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL

• Full Name: protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform
• Calculated Molecular Weight: 309 aa, 36 kDa
• Observed Molecular Weight: 36 kDa
• GenBank Accession Number: BC031696
• Gene Symbol: PPP2CA
• Gene ID (NCBI): 5515
• RRID: AB_3743525
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P67775
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PPP2CA, also named as RP-C and PP2A-alpha, belongs to the PPP phosphatase family and PP-1 subfamily. PP2A can modulate the activity of phosphorylase B kinase casein kinase 2, mitogen-stimulated S6 kinase, and MAP-2 kinase. PP2A activity was modestly decreased in AML patients harboring C-KIT/WT.PP2A is a target for C-KIT/TKD and implicated the potential efficacy of therapies targeting PP2A in such AML in future.