PPP2R2B/A/C/D Polyclonal antibody

PPP2R2B/A/C/D Polyclonal Antibody for WB, IHC, ELISA
Cat No. 29237-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, Mouse, Rat and More (1)

Applications

WB, IHC, ELISA

B55 BETA, B55β, FLJ95686, PP2A B55BETA, PP2A PR55B, PP2A subunit B isoform beta, PP2A subunit B isoform R2 beta, PP2AB BETA, PP2APR55 BETA, PPP2R2B, PPP2R2B/A/C/D, PR2AB BETA, PR2AB55 BETA, PR2APR55 BETA, PR52B, PR55 BETA, SCA12

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells, MCF-7 cells, mouse brain tissue, rat brain tissue
Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:400-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 1 publications below

Product Information

29237-1-AP targets PPP2R2B/A/C/D in WB, IHC, ELISA applications and shows reactivity with Human, Mouse, Rat samples.

Tested Reactivity Human, Mouse, Rat
Cited Reactivitymouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag30757

Product name: Recombinant human PPP2R2B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 290-443 aa of BC031790

Sequence: SHSGRYIMTRDYLTVKVWDLNMENRPIETYQVHDYLRSKLCSLYENDCIFDKFECVWNGSDSVIMTGSYNNFFRMFDRNTKRDVTLEASRENSKPRAILKPRKVCVGGKRRKDEISVDSLDFSKKILHTAWHPSENIIAVAATNNLYIFQDKVN

Predict reactive species
Full Name protein phosphatase 2 (formerly 2A), regulatory subunit B, beta isoform
Calculated Molecular Weight 443 aa, 52 kDa
Observed Molecular Weight 52 kDa
GenBank Accession NumberBC031790
Gene Symbol PPP2R2B
Gene ID (NCBI) 5521
RRIDAB_3086106
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ00005
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The PPP2R2B gene encodes a deduced 443 amino acid protein of approximately 52 kDa, which is a brain-specific regulatory subunit B of protein phosphatase 2. PPP2R2B is a Subunit of PP2A, a highly conserved constitutive enzyme(PMID:11719278). PPP2R2B (Bβ) is an important regulator of protein phosphatase 2A (PP2A) activity in the brain. Through differential promoter usage and alternative splicing, two major isoforms Bβ1 and Bβ2 with divergent sub-cellular targeting N termini are produced. Bβ plays an important role in neuronal survival. It has 5 isoforms produced by alternative splicing. The antibody cross-reacts with PPP2R2A, PPP2R2C, and PPP2R2D due to high immunogen homology between PPP2R2B and PPP2R2A, PPP2R2C, and PPP2R2D.

Protocols

Product Specific Protocols
IHC protocol for PPP2R2B/A/C/D antibody 29237-1-APDownload protocol
WB protocol for PPP2R2B/A/C/D antibody 29237-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Biochim Biophys Acta Mol Cell Res

Hsc70 phosphorylation patterns and calmodulin regulate AP2 CCV life span for cell adhesion protein transport

Authors - G F Sengül
Loading...
||
New chat Able
正在加载,请稍候...