Home
Products
Primary Antibodies
PPP3CA Polyclonal antibody, PBS Only (13422-1-PBS)

Filter: AllWBIPIHCIF/ICCFC (Intra)

WB analysis using 13422-1-AP (same clone as 13422-1-PBS)
RAW 264.7 cell lysates were subjected to SDS PAGE followed by western blot with 13422-1-AP (PPP3CA antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13422-1-PBS in a different storage buffer formulation.
WB analysis of mouse skeletal muscle using 13422-1-AP (same clone as 13422-1-PBS)
mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 13422-1-AP (PPP3CA Antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13422-1-PBS in a different storage buffer formulation.
WB analysis of mouse heart using 13422-1-AP (same clone as 13422-1-PBS)
mouse heart tissue were subjected to SDS PAGE followed by western blot with 13422-1-AP (PPP3CA antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13422-1-PBS in a different storage buffer formulation.
WB analysis of SH-SY5Y using 13422-1-AP (same clone as 13422-1-PBS)
SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 13422-1-AP (PPP3CA antibody) at dilution of 1:0 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13422-1-PBS in a different storage buffer formulation.
IP experiment of mouse brain using 13422-1-AP (same clone as 13422-1-PBS)
IP result of anti-PPP3CA (IP:13422-1-AP, 4ug; Detection:13422-1-AP 1:5000) with mouse brain tissue lysate 1840 ug. This data was developed using the same antibody clone with 13422-1-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 13422-1-AP (same clone as 13422-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 13422-1-AP (PPP3CA Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13422-1-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 13422-1-AP (same clone as 13422-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 13422-1-AP (PPP3CA Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13422-1-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 13422-1-AP (same clone as 13422-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 13422-1-AP (PPP3CA antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13422-1-PBS in a different storage buffer formulation.
IHC staining of human cervical cancer using 13422-1-AP (same clone as 13422-1-PBS)
Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 13422-1-AP (PPP3CA antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13422-1-PBS in a different storage buffer formulation.
IHC staining of human cervical cancer using 13422-1-AP (same clone as 13422-1-PBS)
Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 13422-1-AP (PPP3CA antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13422-1-PBS in a different storage buffer formulation.
IF Staining of SH-SY5Y using 13422-1-AP (same clone as 13422-1-PBS)
Immunofluorescent analysis of (-20°C Ethanol) fixed SH-SY5Y cells using PPP3CA antibody (13422-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 13422-1-PBS in a different storage buffer formulation.
FC experiment of HeLa using 13422-1-AP (same clone as 13422-1-PBS)
1x10^6 HeLa cells were intracellularly stained with 0.25 ug PPP3CA Polyclonal antibody (13422-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Rabbit IgG control Rabbit PolyAb (30000-0-AP) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 13422-1-PBS in a different storage buffer formulation.
×
1x10^6 HeLa cells were intracellularly stained with 0.25 ug PPP3CA Polyclonal antibody (13422-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Rabbit IgG control Rabbit PolyAb (30000-0-AP) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 13422-1-PBS in a different storage buffer formulation.

PPP3CA Polyclonal antibody, PBS Only

PPP3CA Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA

Cat No. 13422-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA

Synonyms

CALNA, CAM PRP catalytic subunit, CALNA1, CALN, Calmodulin-dependent calcineurin A subunit alpha isoform

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

13422-1-PBS targets PPP3CA in WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag4203 Product name: Recombinant human PPP3CA protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 3-302 aa of BC025714 Sequence: EPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSL Predict reactive species
Full Name	protein phosphatase 3 (formerly 2B), catalytic subunit, alpha isoform
Calculated Molecular Weight	59 kDa
Observed Molecular Weight	59 kDa
GenBank Accession Number	BC025714
Gene Symbol	PPP3CA
Gene ID (NCBI)	5530
RRID	AB_2168314
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q08209
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

PPP3CA, also called calcineurin Aα, is the only serine/threonine protein phosphatase under the control of Ca2+/calmodulin, and plays a critical role in the coupling of Ca2+ signals to cellular responses. Ca2+ signaling plays a central role in hypertrophic growth of cardiac and skeletal muscle in response to mechanical load and a variety of signals. Therefore, PPP3CA plays an important role in muscle differentiation, especially in muscle fiber type conversion. It is also involved in osteoclast regulation, regulating bone formation through an effect on osteoblast differentiation.