PPP3CA Monoclonal antibody

PPP3CA Monoclonal Antibody for WB, IHC, IP, ELISA
Cat No. 68163-1-Ig
Clone No.2A5C1

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IHC, IP, ELISA

CALNA, CALNA1, CALN, Calmodulin-dependent calcineurin A subunit alpha isoform, Calcineurin A alpha

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inSH-SY5Y cells, rabbit skeletal muscle tissue, pig brain tissue, rabbit brain tissue, rat brain tissue, mouse brain tissue, rat skeletal muscle
Positive IP detected inrat brain tissue
Positive IHC detected inhuman thyroid cancer tissue, mouse skeletal muscle tissue, rat skeletal muscle tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

68163-1-Ig targets PPP3CA in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

Tested Reactivity human, mouse, rat, pig, rabbit
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag32642

Product name: Recombinant human PPP3CA protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 3-302 aa of BC025714

Sequence: EPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSL

Predict reactive species
Full Name protein phosphatase 3 (formerly 2B), catalytic subunit, alpha isoform
Calculated Molecular Weight 59 kDa
Observed Molecular Weight59 kDa
GenBank Accession NumberBC025714
Gene Symbol PPP3CA
Gene ID (NCBI) 5530
RRIDAB_2923682
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ08209
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PPP3CA, also called calcineurin Aα, is the only serine/threonine protein phosphatase under the control of Ca2+/calmodulin, and plays a critical role in the coupling of Ca2+ signals to cellular responses. Ca2+ signaling plays a central role in hypertrophic growth of cardiac and skeletal muscle in response to mechanical load and a variety of signals. Therefore, PPP3CA plays an important role in muscle differentiation, especially in muscle fiber type conversion. It is also involved in osteoclast regulation, regulating bone formation through an effect on osteoblast differentiation.

Protocols

Product Specific Protocols
IF protocol for PPP3CA antibody 68163-1-IgDownload protocol
IHC protocol for PPP3CA antibody 68163-1-IgDownload protocol
IP protocol for PPP3CA antibody 68163-1-IgDownload protocol
WB protocol for PPP3CA antibody 68163-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Nora (Verified Customer) (02-05-2025)

Worked and showed all the protein isoforms

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: iPSC-CM
Loading...
||
New chat

Able

正在加载,请稍候...