PPP3CA Monoclonal antibody, PBS Only

PPP3CA Monoclonal Antibody for WB, IHC, IP, Indirect ELISA
Cat No. 68163-1-PBS
Clone No.2A5C1

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IHC, IP, Indirect ELISA

CALNA, CALNA1, CALN, Calmodulin-dependent calcineurin A subunit alpha isoform, Calcineurin A alpha

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68163-1-PBS targets PPP3CA in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

Tested Reactivity human, mouse, rat, pig, rabbit
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag32642

Product name: Recombinant human PPP3CA protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 3-302 aa of BC025714

Sequence: EPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSL

Predict reactive species
Full Name protein phosphatase 3 (formerly 2B), catalytic subunit, alpha isoform
Calculated Molecular Weight 59 kDa
Observed Molecular Weight59 kDa
GenBank Accession NumberBC025714
Gene Symbol PPP3CA
Gene ID (NCBI) 5530
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ08209
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

PPP3CA, also called calcineurin Aα, is the only serine/threonine protein phosphatase under the control of Ca2+/calmodulin, and plays a critical role in the coupling of Ca2+ signals to cellular responses. Ca2+ signaling plays a central role in hypertrophic growth of cardiac and skeletal muscle in response to mechanical load and a variety of signals. Therefore, PPP3CA plays an important role in muscle differentiation, especially in muscle fiber type conversion. It is also involved in osteoclast regulation, regulating bone formation through an effect on osteoblast differentiation.

Loading...
||
New chat Able
正在加载,请稍候...