PPP3CB Monoclonal antibody

• 

  WB analysis using 66614-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66614-1-Ig (PPP3CB antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat brain using 66614-1-Ig

  rat brain tissue were subjected to SDS PAGE followed by western blot with 66614-1-Ig (PPP3CB antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 66614-1-Ig

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 66614-1-Ig (PPP3CB antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of NIH/3T3 using 66614-1-Ig

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 66614-1-Ig (PPP3CB antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of fetal human brain using 66614-1-Ig

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 66614-1-Ig (PPP3CB antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 66614-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using PPP3CB antibody (66614-1-Ig, Clone: 3C1A3 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1).

• 

  IF Staining of U-251 using 66614-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed U-251 cells using PPP3CB antibody (66614-1-Ig, Clone: 3C1A3 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1).

• Featured Product
• KD/KO Validated

PPP3CB Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 66614-1-Ig

Clone No.3C1A3

Publications(1)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IF/ICC, ELISA

Synonyms

CALNA2, 3C1A3, Calmodulin-dependent calcineurin A subunit beta isoform, CALNB, CAM PRP catalytic subunit

---

Tested Applications

• Positive WB detected in: pig brain tissue, NIH/3T3 cells, fetal human brain tissue, rat brain tissue, mouse brain tissue
• Positive IF/ICC detected in: HeLa cells, U-251 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:10000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below

Product Information

66614-1-Ig targets PPP3CB in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Cited Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26987

  Product name: Recombinant human PPP3CB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 365-525 aa of BC028049

  Sequence: FVGEKVTEMLVNVLSICSDDELMTEGEDQFDGSAAARKEIIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRICSFEEAKGLDRINERMPPRKDAVQQDGFNSLNTAHATENHGTGNHTAQ

• Full Name: protein phosphatase 3 (formerly 2B), catalytic subunit, beta isoform
• Calculated Molecular Weight: 525 aa, 59 kDa
• Observed Molecular Weight: 59 kDa
• GenBank Accession Number: BC028049
• Gene Symbol: PPP3CB
• Gene ID (NCBI): 5532
• RRID: AB_2881974
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P16298
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PPP3CB is one of the three isoforms of the A subunit of calcineurin (CnA). Calcineurin is a calcium-dependent serine/threonine phosphatase. It consists of two subunits: subunit A (CnA) and subunit B (CnB). For CnA, three isoforms PPP3CA (CnAα), PPP3CB (CnAβ) and PPP3CC (CnAγ) have been identified. PPP3CB is a calcium-dependent, calmodulin-stimulated protein phosphatase. It may have a role in the calmodulin activation of calcineurin.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB	Autophagy; Narirutin activates TFEB (transcription factor EB) to protect against acetaminophen-induced liver injury by targeting PPP3/calcineurin; Authors - Zhiyuan Fang ; KD Validated