PPP3CB Monoclonal antibody, PBS Only

• 

  WB analysis using 66614-1-Ig (same clone as 66614-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66614-1-Ig (PPP3CB antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66614-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat brain using 66614-1-Ig (same clone as 66614-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 66614-1-Ig (PPP3CB antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66614-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 66614-1-Ig (same clone as 66614-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 66614-1-Ig (PPP3CB antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66614-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 66614-1-Ig (same clone as 66614-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 66614-1-Ig (PPP3CB antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66614-1-PBS in a different storage buffer formulation.

• 

  WB analysis of fetal human brain using 66614-1-Ig (same clone as 66614-1-PBS)

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 66614-1-Ig (PPP3CB antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66614-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 66614-1-Ig (same clone as 66614-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using PPP3CB antibody (66614-1-Ig, Clone: 3C1A3 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 66614-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U-251 using 66614-1-Ig (same clone as 66614-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed U-251 cells using PPP3CB antibody (66614-1-Ig, Clone: 3C1A3 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 66614-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

PPP3CB Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 66614-1-PBS

Clone No.3C1A3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

CALNA2, 3C1A3, Calmodulin-dependent calcineurin A subunit beta isoform, CALNB, CAM PRP catalytic subunit

---

Product Information

66614-1-PBS targets PPP3CB in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26987

  Product name: Recombinant human PPP3CB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 365-525 aa of BC028049

  Sequence: FVGEKVTEMLVNVLSICSDDELMTEGEDQFDGSAAARKEIIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRICSFEEAKGLDRINERMPPRKDAVQQDGFNSLNTAHATENHGTGNHTAQ

• Full Name: protein phosphatase 3 (formerly 2B), catalytic subunit, beta isoform
• Calculated Molecular Weight: 525 aa, 59 kDa
• Observed Molecular Weight: 59 kDa
• GenBank Accession Number: BC028049
• Gene Symbol: PPP3CB
• Gene ID (NCBI): 5532
• RRID: AB_2881974
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P16298
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PPP3CB is one of the three isoforms of the A subunit of calcineurin (CnA). Calcineurin is a calcium-dependent serine/threonine phosphatase. It consists of two subunits: subunit A (CnA) and subunit B (CnB). For CnA, three isoforms PPP3CA (CnAα), PPP3CB (CnAβ) and PPP3CC (CnAγ) have been identified. PPP3CB is a calcium-dependent, calmodulin-stimulated protein phosphatase. It may have a role in the calmodulin activation of calcineurin.