PPP4R1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PPP4R1 Polyclonal antibody (27805-1-AP)

• Featured Product
• KD/KO Validated

PPP4R1 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 27805-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

Human and More (1)

Applications

WB, IP, IF, IHC, ELISA

Synonyms

MEG1, PP4(Rmeg), PP4R1, PPP4R1

• 

  WB analysis using 27805-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27805-1-AP (PPP4R1 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 27805-1-AP

  WB result of PPP4R1 antibody (27805-1-AP; 1:10000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PPP4R1 transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 27805-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27805-1-AP (PPP4R1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HEK-293T using 27805-1-AP

  IP result of anti-PPP4R1 (IP:27805-1-AP, 4ug; Detection:27805-1-AP 1:2000) with HEK-293T cells lysate 4000 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 27805-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 27805-1-AP (PPP4R1 antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 27805-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 27805-1-AP (PPP4R1 antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PPP4R1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293T cells, HeLa cells, HEK-293 cells, A431 cells
• Positive IP detected in: HEK-293T cells
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27805-1-AP targets PPP4R1 in WB, IP, IF, IHC, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26405

  Product name: Recombinant human PPP4R1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 331-520 aa of BC060829

  Sequence: NRTRDQEAPEDVQVRPEDTPSDLSVSNSSVILENTMEDHAAEASGKPLGEISVPLDSSLLCTLSSESHQEAASNENDKKPGNYKSMLRPEVGTTSQDSALLDQELYNSFHFWRTPLPEIDLDIELEQNSGGKPSPEGPEEESEGPVPSSPNITMATRKELEEMIENLEPHIDDPDVKAQVEVLSAALRAS

• Full Name: protein phosphatase 4, regulatory subunit 1
• Calculated Molecular Weight: 107 kDa
• Observed Molecular Weight: 120-130 kDa
• GenBank Accession Number: BC060829
• Gene Symbol: PPP4R1
• Gene ID (NCBI): 9989
• RRID: AB_2880978
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TF05
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The PPP4R1 Polyclonal antibody (Cat# 27805-1-AP) has 2 citations. These appear in Cell Death & Differentiation (2024) and Cancer Letters (2024). The cited research covers intestinal inflammation and autophagy-independent signaling, as well as glycolysis and gallbladder cancer progression. Applications used include WB, IP, IF, and IHC in human samples.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IP	Cell Death Differ; AMBRA1 promotes intestinal inflammation by antagonizing PP4R1/PP4c mediated IKK dephosphorylation in an autophagy-independent manner; Authors - Weimin Xu
human	WB,IHC,IF,IP	Cancer Lett; PP4R1 promotes glycolysis and gallbladder cancer progression through facilitating ERK1/2 mediated PKM2 nuclear translocation; Authors - Zhiqiang He