PPP5C Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PPP5C Polyclonal antibody, PBS Only (11715-1-PBS)

• 

  WB analysis using 11715-1-AP (same clone as 11715-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11715-1-AP (PPP5C antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11715-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 11715-1-AP (same clone as 11715-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 11715-1-AP (PPP5C antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11715-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 11715-1-AP (same clone as 11715-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 11715-1-AP (PPP5C antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11715-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

PPP5C Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 11715-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

11715-1-PBS targets PPP5C in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2288

  Product name: Recombinant human PPP5C protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 150-500 aa of BC001970

  Sequence: RAIAGDEHKRSVVDSLDIESMTIEDEYSGPKLEDGKVTISFMKELMQWYKDQKKLHRKCAYQILVQVKEVLSKLSTLVETTLKETEKITVCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQCINGKVLIMHGGLFSEDGVTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSISKRGVSCQFGPDVTKAFLEENNLDYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQGSDLRPQFHQFTAVPHPNVKPMAYANTLLQLGMM

• Full Name: protein phosphatase 5, catalytic subunit
• Calculated Molecular Weight: 499 aa, 57 kDa
• Observed Molecular Weight: 57 kDa
• GenBank Accession Number: BC001970
• Gene Symbol: PPP5C
• Gene ID (NCBI): 5536
• RRID: AB_2237478
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P53041
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.