PPT1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PPT1 Polyclonal antibody, PBS Only (29653-1-PBS)

• 

  WB analysis using 29653-1-AP (same clone as 29653-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29653-1-AP (PPT1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29653-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 29653-1-AP (same clone as 29653-1-PBS)

  WB result of PPT1 antibody (29653-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PPT1 transfected A549 cells. This data was developed using the same antibody clone with 29653-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 29653-1-AP (same clone as 29653-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 29653-1-AP (PPT1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29653-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 29653-1-AP (same clone as 29653-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 29653-1-AP (PPT1 antibody) at dilution of 1:400 (under 10x lens). Heat-mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29653-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse testis using 29653-1-AP (same clone as 29653-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse testis tissue using PPT1 antibody (29653-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 29653-1-PBS in a different storage buffer formulation.

• 

  IF Staining of rat brain using 29653-1-AP (same clone as 29653-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed frozen OCT-embedded rat brain tissue using PPT1 antibody (29653-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 29653-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

PPT1 Polyclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 29653-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

CLN1, EC:3.1.2.22, INCL, Palmitoyl-protein hydrolase 1, Palmitoyl-protein thioesterase 1

---

Product Information

29653-1-PBS targets PPT1 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31240

  Product name: Recombinant human PPT1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 150-306 aa of BC008426

  Sequence: PRCPGESSHICDFIRKTLNAGAYSKVVQERLVQAEYWHDPIKEDVYRNHSIFLADINQERGINESYKKNLMALKKFVMVKFLNDSIVDPVDSEWFGFYRSGQAKETIPLQETSLYTQDRLGLKEMDNAGQLVFLATEGDHLQLSEEWFYAHIIPFLG

• Full Name: palmitoyl-protein thioesterase 1
• Calculated Molecular Weight: 34 kDa
• Observed Molecular Weight: 32-34 kDa
• GenBank Accession Number: BC008426
• Gene Symbol: PPT1
• Gene ID (NCBI): 5538
• RRID: AB_2923599
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P50897
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The defective gene behind the INCL(infantile neuronal ceroid lipofuscinoses) disease, CLN1, encodes for palmitoyl protein thioesterase 1 (PPT1). It consists of 306 amino acids, including a signal sequence of 26 amino acids and three N-linked glycosylation sites. This protein exists with a molecular mass of 32 kDa, 34 kDa,36 kDa, and 38 kDa. The enzyme is transported into lysosomes of non-neuronal cells by the mannose 6-phosphate receptor (M6PR) mediated pathway and a significant amount of native PPT1 resides in a complex rather than in a monomeric form(PMID:17565660).