PQBP1 Recombinant monoclonal antibody

PQBP1 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 84491-6-RR
Clone No.241901B11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

241901B11, Npw38, Polyglutamine tract-binding protein 1, Polyglutamine-binding protein 1, PQBP-1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HEK-293T cells, mouse pancreas tissue, rat brain tissue, rat thymus tissue
Positive IHC detected inhuman ovary cancer tissue, human placenta tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells, NIH/3T3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

84491-6-RR targets PQBP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag9329

Product name: Recombinant human PQBP1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-265 aa of BC012358

Sequence: MPLPVALQTRLAKRGILKHLEPEPEEEIIAEDYDDDPVDYEATRLEGLPPSWYKVFDPSCGLPYYWNADTDLVSWLSPHDPNSVVTKSAKKLRSSNADAEEKLDRSHDKSDRGHDKSDRSHEKLDRGHDKSDRGHDKSDRDRERGYDKVDRERERDRERDRDRGYDKADREEGKERRHHRREELAPYPKSKKAVSRKDEELDPMDPSSYSDAPRGTWSTGLPKRNEAKTGADTTAAGPLFQQRPYPSPGAVLRANAEASRTKQQD

Predict reactive species
Full Name polyglutamine binding protein 1
Calculated Molecular Weight 265 aa, 30 kDa
Observed Molecular Weight 30-32 kDa
GenBank Accession NumberBC012358
Gene Symbol PQBP1
Gene ID (NCBI) 10084
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDO60828
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PQBP1 (Polyglutamine-binding protein 1) is also named as NPW38 and JM26. PQBP1 senses extrinsic tau 3R/4R proteins by direct interaction and triggers an innate immune response by activating a cyclic GMP-AMP synthase (cGAS)-Stimulator of interferon genes (STING) pathway (PMID: 34782623).  PQBP1 is abundantly expressed in the central nervous system during development. PQBP1 is a component of the precatalytic spliceosome (B complex) that is involved in splicing. PQBP1 was predominantly localized in the cell nucleus. PQBP1 is overexpressed in various cancer types including breast cancer, colon cancer, and glioblastoma (PMID: 38342602).

Protocols

Product Specific Protocols
IF protocol for PQBP1 antibody 84491-6-RRDownload protocol
IHC protocol for PQBP1 antibody 84491-6-RRDownload protocol
WB protocol for PQBP1 antibody 84491-6-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...