PRDM15 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PRDM15 Polyclonal antibody, PBS Only (25590-1-PBS)

• 

  WB analysis of Jurkat cells using 25590-1-AP (same clone as 25590-1-PBS)

  WB result of PRDM15 (25590-1-AP, 1:500) with si-control and si-PRDM15 transfected Jurkat cells. This data was developed using the same antibody clone with 25590-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 25590-1-AP (same clone as 25590-1-PBS)

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 25590-1-AP (PRDM15 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25590-1-PBS in a different storage buffer formulation.

• 

  IP experiment of MCF-7 using 25590-1-AP (same clone as 25590-1-PBS)

  IP result of anti-PRDM15 (IP:25590-1-AP, 5ug; Detection:25590-1-AP 1:500) with MCF-7 cells lysate 2500ug. This data was developed using the same antibody clone with 25590-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

PRDM15 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 25590-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, Indirect ELISA

Synonyms

---

Product Information

25590-1-PBS targets PRDM15 in WB, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22296

  Product name: Recombinant human PRDM15 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 791-1141 aa of BC067102

  Sequence: KHCKRHTGIKDFMCELCGKTFSERNTMETHKLIHTVGKQWTCSVCDKKYVTEYMLQKHVQLTHDKVEAQSCQLCGTKVSTRASMSRHMRRKHPEVLAVRIDDLDHLPETTTIDASSIGIVQPELTLEQEDLAEGKHGKAAKRSHKRKQKPEEEAGAPVPEDATFSEYSEKETEFTGSVGDETNSAVQSIQQVVVTLGDPNVTTPSSSVGLTNITVTPITTAAATQFTNLQPVAVGHLTTPERQLQLDNSILTVTFDTVSGSAMLHNRQNDVQIHPQPEASNPQSVAHFINLTTLVNSITPLGSQLSDQHPLTWRAVPQTDVLPPPQPQAPPQQAAQPQVQAEQQQQQMYSY

• Full Name: PR domain containing 15
• Calculated Molecular Weight: 1507 aa, 169 kDa
• Observed Molecular Weight: 169 kDa
• GenBank Accession Number: BC067102
• Gene Symbol: PRDM15
• Gene ID (NCBI): 63977
• RRID: AB_2880145
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P57071
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The PR-domain containing proteins (PRDMs) have a common involvement in the modulation of gene activities. A PR-domain family member usually produces two products, called PR-plus and PR-minus, which differ by the presence or absence of the PR domain, respectively. The PR-plus product is underexpressed or disrupted in cancer cells, whereas the PR-minus product is present or overexpressed in cancer cells. This imbalance in the amount of the two products, which is a result of either genetic or epigenetic events, appears to be a determining factor of malignancy. PRDM15 (PR domain-containing protein 15), also known as PFM15 or ZNF298, is a 1507 amino acid protein belonging to the PRDM family. Localizing to the nucleus, PRDM15 contains sixteen C2H2-type zinc fingers and one SET domain. It is believed to participate in transcriptional regulation and may be involved in cell differentiation and tumorigenesis. PRDM15 exists several isoform and molecular weight of respective isoform is 169 kDa, 135kda, 62kDa.