PRDM4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PRDM4 Polyclonal antibody, PBS Only (13792-1-PBS)

• 

  WB analysis of mouse pancreas using 13792-1-AP (same clone as 13792-1-PBS)

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 13792-1-AP (PRDM4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13792-1-PBS in a different storage buffer formulation.

• 

  WB analysis of COLO 320 using 13792-1-AP (same clone as 13792-1-PBS)

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 13792-1-AP (PRDM4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13792-1-PBS in a different storage buffer formulation.

PRDM4 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 13792-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

13792-1-PBS targets PRDM4 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4580

  Product name: Recombinant human PRDM4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 451-801 aa of BC035581

  Sequence: EVAEWTDKAVNHIWKIYHNGVLEFCIITTDENECNWMMFVRKARNREEQNLVAYPHDGKIFFCTSQDIPPENELLFYYSRDYAQQIGVPEHPDVHLCNCGKECNSYTEFKAHLTSHIHNHLPTQGHSGSHGPSHSKERKWKCSMCPQAFISPSKLHVHFMGHMGMKPHKCDFCSKAFSDPSNLRTHLKIHTGQKNYRCTLCDKSFTQKAHLESHMVIHTGEKNLKCDYCDKLFMRRQDLKQHVLIHTQERQIKCPKCDKLFLRTNHLKKHLNSHEGKRDYVCEKCTKAYLTKYHLTRHLKTCKGPTSSSSAPEEEEEDDSEEEDLADSVGTEDCRINSAVYSADESLSAHK

• Full Name: PR domain containing 4
• Calculated Molecular Weight: 801 aa, 88 kDa
• Observed Molecular Weight: 88 kDa
• GenBank Accession Number: BC035581
• Gene Symbol: PRDM4
• Gene ID (NCBI): 11108
• RRID: AB_10638307
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UKN5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The PRDM family members are characterized by the presence of a PR (positive regulatory) domain and multiple zinc finger (ZnFg) domains. The PR domain defines a family of transcription factors involved in cell differentiation and tumorigenesis. PRDM proteins are either epigenetic modifiers in their own right or else they recruit third party chromatin modifiers - e.g. histone deacetylases (HDACs), histone lysine MTases or histone arginine MTases - to regulate cell type-specific gene expression in various tissues (PRDM4 as an HDAC-associated transcriptional repressor that modulates cell cycle progression.