PRDX2 Recombinant monoclonal antibody, PBS Only (Capture)

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• PRDX2 Recombinant monoclonal antibody, PBS Only (Capture) (86599-3-PBS)

PRDX2 Uni-rAb^® Recombinant Antibody for Sandwich ELISA, Indirect ELISA

Cat No. 86599-3-PBS

Clone No.251494G7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA

Synonyms

peroxiredoxin 2, EC:1.11.1.24, Natural killer cell-enhancing factor B, NKEFB, NKEF-B

• 

  Sandwich ELISA sample test of MP02542-2

  The mean Peroxiredoxin 2 concentration was determined to be 75.74 ng/mL in HepG2 cell extract based on a 1.2 mg/mL extract load.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Sandwich ELISA sample test of MP02542-2

  Plasma of six individual healthy human donors was measured. The human Peroxiredoxin 2 concentration of detected samples was determined to be 6.52 ng/mL with a range of 5.21 - 7.71 ng/mL.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Sandwich ELISA standard curve of MP02542-2

  Sandwich ELISA standard curve of MP02542-2, Human Peroxiredoxin 2 Recombinant Matched Antibody Pair - PBS only. 86599-3-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag0835. 86599-1-PBS was HRP conjugated as the detection antibody. Range: 3.13-200 ng/mL

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

86599-3-PBS targets PRDX2 as part of a matched antibody pair:

MP02542-2: 86599-3-PBS capture and 86599-1-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0835

  Product name: Recombinant human PRDX2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-198 aa of BC003022

  Sequence: MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN

• Full Name: peroxiredoxin 2
• Calculated Molecular Weight: 22 kDa
• GenBank Accession Number: BC003022
• Gene Symbol: peroxiredoxin 2
• Gene ID (NCBI): 7001
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P32119
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.