PREB Polyclonal antibody

• 

  WB analysis of SKOV-3 using 10146-2-AP

  SKOV-3 cells were subjected to SDS PAGE followed by western blot with 10146-2-AP (PREB antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of 3T3-L1 cells using 10146-2-AP

  WB result of anti-PREB (10146-2-AP, 1:250) with HepG2 and HT1080 by Dr. Dzmitry Batrakou.

• 

  WB analysis of HepG2 using 10146-2-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 10146-2-AP (PREB antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of SKOV-3 using 10146-2-AP

  SKOV-3 cells were subjected to SDS PAGE followed by western blot with 10146-2-AP (PREB antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HT-1080 using 10146-2-AP

  HT-1080 cells were subjected to SDS PAGE followed by western blot with 10146-2-AP (PREB antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 10146-2-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 10146-2-AP (PREB antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IP experiment of SKOV-3 using 10146-2-AP

  IP result of anti-PREB (IP:10146-2-AP, 4ug; Detection:10146-2-AP 1:500) with SKOV-3 cells lysate 3200ug.

• 

  IHC staining of human prostate cancer using 10146-2-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 10146-2-AP (PREB Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of mouse intestine using 10146-2-AP

  Immunohistochemical analysis of paraffin-embedded mouse intestine tissue slide using 10146-2-AP (PREB antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary tumor using 10146-2-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 10146-2-AP (PREB Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human ovary tumor using 10146-2-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 10146-2-AP (PREB Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human prostate cancer using 10146-2-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 10146-2-AP (PREB Antibody) at dilution of 1:50 (under 10x lens).

• 

  IF Staining of HepG2 using 10146-2-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using PREB antibody (10146-2-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

PREB Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 10146-2-AP

Publications(8)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

SEC12, Prolactin regulatory element-binding protein, Guanine nucleotide-exchange factor SEC12

---

Tested Applications

• Positive WB detected in: SKOV-3 cells, 3T3-L1 cells , HT-1080 cells, HepG2 cells
• Positive IP detected in: SKOV-3 cells
• Positive IHC detected in: mouse intestine, human ovary tumor tissue, human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 8 publications below
• IF: See 1 publications below
• IP: See 1 publications below
• CoIP: See 1 publications below

Product Information

10146-2-AP targets PREB in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0202

  Product name: Recombinant human PREB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 13-202 aa of BC002765

  Sequence: PFPLYALQVDPSTGLLIAAGGGGAAKTGIKNGVHFLQLELINGRLSASLLHSHDTETRATMNLALAGDILAAGQDAHCQLLRFQAHQQQGNKAEKAGSKEQGPRQRKGAAPAEKKCGAETQHEGLELRVENLQAVQTDFSSDPLQKVVCFNHDNTLLATGGTDGYVRVWKVPSLEKVLEFKAHEGEIEDL

• Full Name: prolactin regulatory element binding
• Calculated Molecular Weight: 45 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC002765
• Gene Symbol: PREB
• Gene ID (NCBI): 10113
• RRID: AB_2168779
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HCU5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PREB contains two PQ-rich potential transactivation domains, but no apparent DNA-binding motif, and exhibits sequence-specific binding to Pit1-binding element of the prolactin (PRL) promoter. It may act as a transcriptional regulator and is thought to be involved in some of the developmental abnormalities observed in patients with partial trisomy 2p.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	EMBO J; The unfolded protein response regulates ER exit sites via SNRPB-dependent RNA splicing and contributes to bone development; Authors - Muhammad Zahoor
mouse,human	WB	Redox Biol; Selenoprotein K contributes to CD36 subcellular trafficking in hepatocytes by accelerating nascent COPII vesicle formation and aggravates hepatic steatosis; Authors - Mengyue You
	IP,WB,IF	Int J Biol Macromol; Cellular OCIAD2 protein is a proviral factor for hepatitis C virus replication.; Authors - Zibing Yang
human	WB,CoIP	J Cell Sci; A Wntless-SEC12 complex on the ER membrane regulates early Wnt secretory vesicle assembly and mature ligand export.; Authors - Jiaxin Sun ; KD Validated
human	WB	Biochem Biophys Res Commun; Pull down assay for GTP-bound form of Sar1a reveals its activation during morphological differentiation.; Authors - Yuri Urai
mouse	WB	Biochim Biophys Acta; Prolactin regulatory element-binding (PREB) protein regulates hepatic glucose homeostasis.; Authors - Joo-Man Park