PREB Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PREB Polyclonal antibody (10146-2-AP)

• Featured Product
• KD/KO Validated

PREB Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 10146-2-AP Copied!

Publications (9)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

SEC12, Prolactin regulatory element-binding protein, Guanine nucleotide-exchange factor SEC12

• 

  WB analysis of SKOV-3 using 10146-2-AP

  SKOV-3 cells were subjected to SDS PAGE followed by western blot with 10146-2-AP (PREB antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of 3T3-L1 cells using 10146-2-AP

  WB result of anti-PREB (10146-2-AP, 1:250) with HepG2 and HT1080 by Dr. Dzmitry Batrakou.

• 

  WB analysis of HT-1080 using 10146-2-AP

  HT-1080 cells were subjected to SDS PAGE followed by western blot with 10146-2-AP (PREB antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 10146-2-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 10146-2-AP (PREB antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of SKOV-3 using 10146-2-AP

  SKOV-3 cells were subjected to SDS PAGE followed by western blot with 10146-2-AP (PREB antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 10146-2-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 10146-2-AP (PREB antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of SKOV-3 using 10146-2-AP

  IP result of anti-PREB (IP:10146-2-AP, 4ug; Detection:10146-2-AP 1:500) with SKOV-3 cells lysate 3200ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 10146-2-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 10146-2-AP (PREB Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse intestine using 10146-2-AP

  Immunohistochemical analysis of paraffin-embedded mouse intestine tissue slide using 10146-2-AP (PREB antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 10146-2-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 10146-2-AP (PREB Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 10146-2-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 10146-2-AP (PREB Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 10146-2-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 10146-2-AP (PREB Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 10146-2-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using PREB antibody (10146-2-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PREB in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: SKOV-3 cells, 3T3-L1 cells , HT-1080 cells, HepG2 cells
• Positive IP detected in: SKOV-3 cells
• Positive IHC detected in: mouse intestine, human ovary tumor tissue, human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10146-2-AP targets PREB in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0202

  Product name: Recombinant human PREB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 13-202 aa of BC002765

  Sequence: PFPLYALQVDPSTGLLIAAGGGGAAKTGIKNGVHFLQLELINGRLSASLLHSHDTETRATMNLALAGDILAAGQDAHCQLLRFQAHQQQGNKAEKAGSKEQGPRQRKGAAPAEKKCGAETQHEGLELRVENLQAVQTDFSSDPLQKVVCFNHDNTLLATGGTDGYVRVWKVPSLEKVLEFKAHEGEIEDL

• Full Name: prolactin regulatory element binding
• Calculated Molecular Weight: 45 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC002765
• Gene Symbol: PREB
• Gene ID (NCBI): 10113
• RRID: AB_2168779
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HCU5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PREB contains two PQ-rich potential transactivation domains, but no apparent DNA-binding motif, and exhibits sequence-specific binding to Pit1-binding element of the prolactin (PRL) promoter. It may act as a transcriptional regulator and is thought to be involved in some of the developmental abnormalities observed in patients with partial trisomy 2p.

Publications

What published studies show

The PREB Polyclonal antibody (Cat# 10146-2-AP) has 9 citations published in journals including Cancer Cell, EMBO J, Cell Death & Differentiation, Redox Biology, International Journal of Biological Macromolecules, Biochimica et Biophysica Acta, Virology Journal, Journal of Cell Science, and Biochemical and Biophysical Research Communications. Research fields span cancer biology, lipid metabolism, hepatic steatosis, viral replication, ER stress, bone development, glucose homeostasis, Wnt signaling, and GTPase regulation.

Automatically generated from the 9 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cancer Cell; Lipid oxidation reprogramming in cancer-associated fibroblasts enhances CD8(+) T cell cytotoxicity and therapeutic response.; Authors - Zikun Ma
mouse,human	WB	Redox Biol; Selenoprotein K contributes to CD36 subcellular trafficking in hepatocytes by accelerating nascent COPII vesicle formation and aggravates hepatic steatosis; Authors - Mengyue You
rat	WB	Cell Death Differ; C9orf72 controls hepatic lipid metabolism by regulating SREBP1 transport; Authors - Yachen Wu
	IP,WB,IF	Int J Biol Macromol; Cellular OCIAD2 protein is a proviral factor for hepatitis C virus replication.; Authors - Zibing Yang
human	WB	EMBO J; The unfolded protein response regulates ER exit sites via SNRPB-dependent RNA splicing and contributes to bone development; Authors - Muhammad Zahoor
mouse	WB	Biochim Biophys Acta; Prolactin regulatory element-binding (PREB) protein regulates hepatic glucose homeostasis.; Authors - Joo-Man Park