PREB Monoclonal antibody, PBS Only

• 

  WB analysis of Daudi using 66981-1-Ig (same clone as 66981-1-PBS)

  Daudi cells were subjected to SDS PAGE followed by western blot with 66981-1-Ig (PREB antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66981-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Ramos using 66981-1-Ig (same clone as 66981-1-PBS)

  Ramos cells were subjected to SDS PAGE followed by western blot with 66981-1-Ig (PREB antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66981-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Raji using 66981-1-Ig (same clone as 66981-1-PBS)

  Raji cells were subjected to SDS PAGE followed by western blot with 66981-1-Ig (PREB antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66981-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 66981-1-Ig (same clone as 66981-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 66981-1-Ig (PREB antibody) at dilution of 1:300 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66981-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 66981-1-Ig (same clone as 66981-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 66981-1-Ig (PREB antibody) at dilution of 1:300 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66981-1-PBS in a different storage buffer formulation.

PREB Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 66981-1-PBS

Clone No.2F6A1

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

2F6A1, Guanine nucleotide-exchange factor SEC12, Prolactin regulatory element-binding protein, SEC12

---

Product Information

66981-1-PBS targets PREB in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28549

  Product name: Recombinant human PREB protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 13-202 aa of BC002765

  Sequence: PFPLYALQVDPSTGLLIAAGGGGAAKTGIKNGVHFLQLELINGRLSASLLHSHDTETRATMNLALAGDILAAGQDAHCQLLRFQAHQQQGNKAEKAGSKEQGPRQRKGAAPAEKKCGAETQHEGLELRVENLQAVQTDFSSDPLQKVVCFNHDNTLLATGGTDGYVRVWKVPSLEKVLEFKAHEGEIEDL

• Full Name: prolactin regulatory element binding
• Calculated Molecular Weight: 45 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC002765
• Gene Symbol: PREB
• Gene ID (NCBI): 10113
• RRID: AB_2882301
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9HCU5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PREB contains two PQ-rich potential transactivation domains, but no apparent DNA-binding motif, and exhibits sequence-specific binding to Pit1-binding element of the prolactin (PRL) promoter. It may act as a transcriptional regulator and is thought to be involved in some of the developmental abnormalities observed in patients with partial trisomy 2p.