PREB Monoclonal antibody

• 

  WB analysis of Daudi using 66981-1-Ig

  Daudi cells were subjected to SDS PAGE followed by western blot with 66981-1-Ig (PREB antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Ramos using 66981-1-Ig

  Ramos cells were subjected to SDS PAGE followed by western blot with 66981-1-Ig (PREB antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Raji using 66981-1-Ig

  Raji cells were subjected to SDS PAGE followed by western blot with 66981-1-Ig (PREB antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human prostate cancer using 66981-1-Ig

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 66981-1-Ig (PREB antibody) at dilution of 1:300 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate cancer using 66981-1-Ig

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 66981-1-Ig (PREB antibody) at dilution of 1:300 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

PREB Monoclonal Antibody for WB, IHC, ELISA

Cat No. 66981-1-Ig

Clone No.2F6A1

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

2F6A1, Guanine nucleotide-exchange factor SEC12, Prolactin regulatory element-binding protein, SEC12

---

Tested Applications

• Positive WB detected in: Daudi cells, Raji cells, Ramos cells
• Positive IHC detected in: human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:150-1:600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66981-1-Ig targets PREB in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28549

  Product name: Recombinant human PREB protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 13-202 aa of BC002765

  Sequence: PFPLYALQVDPSTGLLIAAGGGGAAKTGIKNGVHFLQLELINGRLSASLLHSHDTETRATMNLALAGDILAAGQDAHCQLLRFQAHQQQGNKAEKAGSKEQGPRQRKGAAPAEKKCGAETQHEGLELRVENLQAVQTDFSSDPLQKVVCFNHDNTLLATGGTDGYVRVWKVPSLEKVLEFKAHEGEIEDL

• Full Name: prolactin regulatory element binding
• Calculated Molecular Weight: 45 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC002765
• Gene Symbol: PREB
• Gene ID (NCBI): 10113
• RRID: AB_2882301
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9HCU5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PREB contains two PQ-rich potential transactivation domains, but no apparent DNA-binding motif, and exhibits sequence-specific binding to Pit1-binding element of the prolactin (PRL) promoter. It may act as a transcriptional regulator and is thought to be involved in some of the developmental abnormalities observed in patients with partial trisomy 2p.