PRH1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PRH1 Polyclonal antibody, PBS Only (21460-1-PBS)

• 

  WB analysis of HepG2 using 21460-1-AP (same clone as 21460-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 21460-1-AP (PRH1 Antibody) at dilution of 1:300 incubated at 4 degree celsius over night. This data was developed using the same antibody clone with 21460-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 21460-1-AP (same clone as 21460-1-PBS)

  Immunofluorescent analysis of HepG2 cells using 21460-1-AP (PRH1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 21460-1-PBS in a different storage buffer formulation.

PRH1 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 21460-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

21460-1-PBS targets PRH1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14833

  Product name: Recombinant human PRH1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 17-187 aa of BC064553

  Sequence: QDLNEDVSQEDVPLVISDGGDSEQFLDEERQGPPLGGQQSQPSAGDGNQDDGPQQGPPQQGGQQQQGPPPPQGKPQGPPQQGGQQQQGPPPPQGKPQGPPQQGGHPPPPQGRPQGPPQQGGHPRPPRGRPQGPPQQGGHQQGPPPPPPGKPQGPPPQGGRPQGPPQGQSPQ

• Full Name: proline-rich protein HaeIII subfamily 1
• Calculated Molecular Weight: 17 kDa
• Observed Molecular Weight: 17 kDa
• GenBank Accession Number: BC064553
• Gene Symbol: PRH1
• Gene ID (NCBI): 5554
• RRID: AB_2878862
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P02810
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PRH1, also known as Salivary acidic proline-rich phosphoprotein 1/2, is a 166 amino acid secreted protein whose molecular weight is 17 kDa. It functions as a highly potent inhibitor of calcium phosphate crystal growth. Similar to other PRPs, PRH1 provides a protective and reparative environment for dental enamel, which is important for teeth integrity. This antibody specifically recognises the 17 kDa protein.