PRIM1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PRIM1 Polyclonal antibody (10773-1-AP)

PRIM1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 10773-1-AP Copied!

Publications (12)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ChIP, ELISA

Synonyms

DNA primase 49 kDa subunit, DNA primase small subunit, EC:2.7.7.102, p49

• 

  WB analysis using 10773-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10773-1-AP (PRIM1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 10773-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 10773-1-AP (PRIM1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Sp2/0 using 10773-1-AP

  Sp2/0 cells were subjected to SDS PAGE followed by western blot with 10773-1-AP (PRIM1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of K-562 using 10773-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 10773-1-AP (PRIM1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of K-562 using 10773-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 10773-1-AP (PRIM1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Sp2/0 using 10773-1-AP

  Sp2/0 cells were subjected to SDS PAGE followed by western blot with 10773-1-AP (PRIM1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 10773-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 10773-1-AP (PRIM1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 10773-1-AP

  IP result of anti-PRIM1 (IP:10773-1-AP, 4ug; Detection:10773-1-AP 1:300) with HeLa cells lysate 2800ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lymphoma using 10773-1-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma using 10773-1-AP (PRIM1 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human thyroid cancer using 10773-1-AP

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 10773-1-AP (PRIM1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human thyroid cancer using 10773-1-AP

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 10773-1-AP (PRIM1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 10773-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using PRIM1 antibody (10773-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PRIM1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, Sp2/0 cells, K-562 cells, HepG2 cells, Jurkat cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human lymphoma tissue, human thyroid cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10773-1-AP targets PRIM1 in WB, IHC, IF/ICC, IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1124

  Product name: Recombinant human PRIM1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 121-420 aa of BC005266

  Sequence: CCSSADICPKCWTLMTMAIRIIDRALKEDFGFKHRLWVYSGRRGVHCWVCDESVRKLSSAVRSGIVEYLSLVKGGQDVKKKVHLSEKIHPFIRKSINIIKKYFEEYALVNQDILENKESWDKILALVPETIHDELQQSFQKSHNSLQRWEHLKKVASRYQNNIKNDKYGPWLEWEIMLQYCFPRLDINVSKGINHLLKSPFSVHPKTGRISVPIDLQKVDQFDPFTVPTISFICRELDAISTNEEEKEENEAESDVKHRTRDYKKTSLAPYVKVFEHFLENLDKSRKGELLKKSDLQKDF

• Full Name: primase, DNA, polypeptide 1 (49kDa)
• Calculated Molecular Weight: 50 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC005266
• Gene Symbol: PRIM1
• Gene ID (NCBI): 5557
• RRID: AB_2237549
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P49642
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DNA replication in human cells is initiated by a complex apparatus containing a DNA polymerase-alpha/primase complex. Primase synthesizes oligoribonucleotides that serve as primers for the initiation of DNA synthesis. It plays a role in both the initiation of DNA replication and the synthesis of Okazaki fragments for lagging strand synthesis. PRIM1 is a subnuit of this complex.

Publications

What published studies show

The PRIM1 polyclonal antibody (Cat# 10773-1-AP) has 12 citations published in journals including Nature Cell Biology, Nature Communications, Nucleic Acids Research, Cell Reports, International Journal of Molecular Sciences, DNA Repair, PLoS One, and bioRxiv. The research fields span DNA replication and repriming, double-strand break repair, break-induced replication, telomerase regulation, BRCA1-deficient cell biology, and osteosarcoma modeling.

Automatically generated from the 12 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Cell Biol; 53BP1-shieldin-dependent DSB processing in BRCA1-deficient cells requires CST-Polα-primase fill-in synthesis.; Authors - Zachary Mirman
	WB	Nat Commun; RTF2 controls replication repriming and ribonucleotide excision at the replisome; Authors - Brooke A Conti
human	WB	Nat Commun; 53BP1 deficiency leads to hyperrecombination using break-induced replication (BIR); Authors - Sameer Bikram Shah
human	WB	Nucleic Acids Res; CST does not evict elongating telomerase but prevents initiation by ssDNA binding.; Authors - Arthur J Zaug
human	WB,ChIP	Cell Rep; Break-induced replication is activated to repair R-loop-associated double-strand breaks in SETX-deficient cells.; Authors - Tong Wu ; KD Validated
mouse		Cell Rep; A Key Role for the Ubiquitin Ligase UBR4 in Myofiber Hypertrophy in Drosophila and Mice.; Authors - Liam C Hunt