PRIM1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86051-1-RR (same clone as 86051-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86051-1-RR (PRIM1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86051-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86051-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86051-1-RR against Human PRIM1 were performed. The affinity constant is 27.2 pM.

PRIM1 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86051-1-PBS

Clone No.250690B8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

DNA primase 49 kDa subunit, DNA primase small subunit, EC:2.7.7.102, p49

---

Product Information

86051-1-PBS targets PRIM1 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1124

  Product name: Recombinant human PRIM1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 121-420 aa of BC005266

  Sequence: CCSSADICPKCWTLMTMAIRIIDRALKEDFGFKHRLWVYSGRRGVHCWVCDESVRKLSSAVRSGIVEYLSLVKGGQDVKKKVHLSEKIHPFIRKSINIIKKYFEEYALVNQDILENKESWDKILALVPETIHDELQQSFQKSHNSLQRWEHLKKVASRYQNNIKNDKYGPWLEWEIMLQYCFPRLDINVSKGINHLLKSPFSVHPKTGRISVPIDLQKVDQFDPFTVPTISFICRELDAISTNEEEKEENEAESDVKHRTRDYKKTSLAPYVKVFEHFLENLDKSRKGELLKKSDLQKDF

• Full Name: primase, DNA, polypeptide 1 (49kDa)
• Calculated Molecular Weight: 50 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC005266
• Gene Symbol: PRIM1
• Gene ID (NCBI): 5557
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P49642
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DNA replication in human cells is initiated by a complex apparatus containing a DNA polymerase-alpha/primase complex. Primase synthesizes oligoribonucleotides that serve as primers for the initiation of DNA synthesis. It plays a role in both the initiation of DNA replication and the synthesis of Okazaki fragments for lagging strand synthesis. PRIM1 is a subunit of this complex.