PRKACA Polyclonal antibody

• 

  WB analysis using 24503-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24503-1-AP (PRKACA antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 24503-1-AP

  WB result of PRKACA antibody (24503-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PRKACA transfected HeLa cells.

• 

  IHC staining of human breast cancer using 24503-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 24503-1-AP (PRKACA antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 24503-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 24503-1-AP (PRKACA antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

PRKACA Polyclonal Antibody for WB, IHC, ELISA

Cat No. 24503-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

PKA C alpha, PKACA, PRKACA

---

Tested Applications

• Positive WB detected in: Neuro-2a cells, HeLa cells, SH-SY5Y cells, mouse testis tissue, rat testis tissue
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 4 publications below
• IF: See 1 publications below

Product Information

24503-1-AP targets PRKACA in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21478

  Product name: Recombinant human PRKACA protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-351 aa of BC039846

  Sequence: MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF

• Full Name: protein kinase, cAMP-dependent, catalytic, alpha
• Calculated Molecular Weight: 41 kDa
• Observed Molecular Weight: 38-43 kDa
• GenBank Accession Number: BC039846
• Gene Symbol: PRKACA
• Gene ID (NCBI): 5566
• RRID: AB_2879578
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P17612
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	Front Pharmacol; Integrating network pharmacology and experimental verification to explore the mechanism of puerarin against oliguria in acute alcoholism; Authors - Mei-Xuan Wan
mouse	WB,IF	Cell Mol Life Sci; ZMYND12 serves as an IDAd subunit that is essential for sperm motility in mice; Authors - Chang Wang
human,mouse	WB	Stem Cell Res Ther; MSCs-derived HGF alleviates senescence by inhibiting unopposed mitochondrial fusion-based elongation in post-acute kidney injury; Authors - Kaiting Zhuang
rat	WB	Phytomedicine; Peiyuan Ningshen-ointment alleviates learning and memory impairment induced by sleep deprivation through activating the cAMP/PKA signaling pathway; Authors - Xiao-Yu Wei