PKC Alpha Recombinant monoclonal antibody

PKC Alpha Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA
Cat No. 83840-6-RR
Clone No.240926E1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA

PRKCA, 240926E1, AAG6, EC:2.7.11.13, PKC A

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HEK-293 cells, Jurkat cells, NIH/3T3 cells, C6 cells, human platelets tissue, rat brain tissue
Positive IHC detected inhuman stomach cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inrat eye tissue
Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:400-1:1600
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:125-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83840-6-RR targets PKC Alpha in WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1025

Product name: Recombinant human PRKCA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-216 aa of BC109274

Sequence: MADVFPGNDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGSLLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIR

Predict reactive species
Full Name protein kinase C, alpha
Observed Molecular Weight77 kDa
GenBank Accession NumberBC109274
Gene Symbol PKC Alpha
Gene ID (NCBI) 5578
RRIDAB_3671424
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP17252
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and the second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play a distinct role in cells. PRKCA is one of the PKC family members. This kinase has been reported to play roles in many different cellular processes, such as cell adhesion, cell transformation, cell cycle checkpoint, and cell volume control. Knockout studies in mice suggest that this kinase may be a fundamental regulator of cardiac contractility and Ca(2+) handling in myocytes.

Protocols

Product Specific Protocols
WB protocol for PKC Alpha antibody 83840-6-RRDownload protocol
IHC protocol for PKC Alpha antibody 83840-6-RRDownload protocol
IF protocol for PKC Alpha antibody 83840-6-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...