DNA-PKcs Polyclonal antibody

DNA-PKcs Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 28534-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

DNAPK, DNPK1, PRKDC, DNA-PK catalytic subunit, DNA-dependent protein kinase catalytic subunit

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, MCF-7 cells
Positive IHC detected inmouse testis tissue, human kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 2 publications below

Product Information

28534-1-AP targets DNA-PKcs in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag29100

Product name: Recombinant human PRKDC protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 3979-4128 aa of NM_006904

Sequence: LMYSIMVHALRAFRSDPGLLTNTMDVFVKEPSFDWKNFEQKMLKKGGSWIQEINVAEKNWYPRQKICYAKRKLAGANPAVITCDELLLGHEKAPAFRDYVAVARGSKDHNIRAQEPESGLSEETQVKCLMDQATDPNILGRTWEGWEPWM

Predict reactive species
Full Name protein kinase, DNA-activated, catalytic polypeptide
Calculated Molecular Weight 469 kDa
Observed Molecular Weight 350-460 kDa
GenBank Accession NumberNM_006904
Gene Symbol PRKDC
Gene ID (NCBI) 5591
RRIDAB_2881165
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP78527
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PRKDC, also named as HYRC, HYRC1, DNPK1 and p460, belongs to the PI3/PI4-kinase family. PRKDC is a serine/threonine-protein kinase that acts as a molecular sensor for DNA damage. Involved in DNA nonhomologous end joining (NHEJ), PRKDC is required for double-strand break (DSB) repair and V(D)J recombination. PRKDC must be bound to DNA to express its catalytic properties. It promotes processing of hairpin DNA structures in V(D)J recombination by activation of the hairpin endonuclease artemis (DCLRE1C). It is required to protect and align broken ends of DNA. PRKDC may also act as a scaffold protein to aid the localization of DNA repair proteins to the site of damage. It is found at the ends of chromosomes, suggesting a further role in the maintenance of telomeric stability and the prevention of chromosomal end fusion. It also involved in modulation of transcription. It recognizes the substrate consensus sequence [ST]-Q. PRKDC phosphorylates 'Ser-139' of histone variant H2AX/H2AFX, thereby regulating DNA damage response mechanism. It phosphorylates DCLRE1C, c-Abl/ABL1, histone H1, HSPCA, c-jun/JUN, p53/TP53, PARP1, POU2F1, DHX9, SRF, XRCC1, XRCC1, XRCC4, XRCC5, XRCC6, WRN, c-myc/MYC and RFA2. The antibody recognizes the C-term of PRKDC.

Protocols

Product Specific Protocols
IF protocol for DNA-PKcs antibody 28534-1-APDownload protocol
IHC protocol for DNA-PKcs antibody 28534-1-APDownload protocol
WB protocol for DNA-PKcs antibody 28534-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Sci Adv

SMYD2 inhibition-mediated hypomethylation of Ku70 contributes to impaired nonhomologous end joining repair and antitumor immunity

Authors - Ming Tang
humanWB

Exp Hematol

Peposertib suppresses generation of FLT3-internal tandem duplication formed by contralateral double nicks

Authors - Shota Yoshida
Loading...
||
New chat

Able

正在加载,请稍候...