CoraLite® Plus 488-conjugated DNA-PKcs Polyclonal antibody

• 

  IF Staining of HeLa using CL488-28534

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CoraLite® Plus 488 DNA-PKcs antibody (CL488-28534) at dilution of 1:100.

DNA-PKcs Polyclonal Antibody for IF/ICC

Cat No. CL488-28534

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

DNAPK, DNPK1, PRKDC, DNA-PK catalytic subunit, DNA-dependent protein kinase catalytic subunit

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-28534 targets DNA-PKcs in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29100

  Product name: Recombinant human PRKDC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 3979-4128 aa of NM_006904

  Sequence: LMYSIMVHALRAFRSDPGLLTNTMDVFVKEPSFDWKNFEQKMLKKGGSWIQEINVAEKNWYPRQKICYAKRKLAGANPAVITCDELLLGHEKAPAFRDYVAVARGSKDHNIRAQEPESGLSEETQVKCLMDQATDPNILGRTWEGWEPWM

• Full Name: protein kinase, DNA-activated, catalytic polypeptide
• Calculated Molecular Weight: 469 kDa
• Observed Molecular Weight: 350-460 kDa
• GenBank Accession Number: NM_006904
• Gene Symbol: PRKDC
• Gene ID (NCBI): 5591
• RRID: AB_3084116
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Excitation Laser: Blue laser (488 nm)
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P78527
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

PRKDC, also named as HYRC, HYRC1, DNPK1 and p460, belongs to the PI3/PI4-kinase family. PRKDC is a serine/threonine-protein kinase that acts as a molecular sensor for DNA damage. Involved in DNA nonhomologous end joining (NHEJ), PRKDC is required for double-strand break (DSB) repair and V(D)J recombination. PRKDC must be bound to DNA to express its catalytic properties. It promotes processing of hairpin DNA structures in V(D)J recombination by activation of the hairpin endonuclease artemis (DCLRE1C). It is required to protect and align broken ends of DNA. PRKDC may also act as a scaffold protein to aid the localization of DNA repair proteins to the site of damage. It is found at the ends of chromosomes, suggesting a further role in the maintenance of telomeric stability and the prevention of chromosomal end fusion. It also involved in modulation of transcription. It recognizes the substrate consensus sequence [ST]-Q. PRKDC phosphorylates 'Ser-139' of histone variant H2AX/H2AFX, thereby regulating DNA damage response mechanism. It phosphorylates DCLRE1C, c-Abl/ABL1, histone H1, HSPCA, c-jun/JUN, p53/TP53, PARP1, POU2F1, DHX9, SRF, XRCC1, XRCC1, XRCC4, XRCC5, XRCC6, WRN, c-myc/MYC and RFA2. The antibody recognizes the C-term of PRKDC.