CoraLite® Plus 488-conjugated DNA-PKcs Polyclonal antibody

• 

  IF Staining of HeLa using CL488-28534

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CoraLite® Plus 488 DNA-PKcs antibody (CL488-28534) at dilution of 1:100.

DNA-PKcs Polyclonal Antibody for IF/ICC

Cat No. CL488-28534

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

DNAPK, DNPK1, PRKDC, DNA-PK catalytic subunit, DNA-dependent protein kinase catalytic subunit

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-28534 targets DNA-PKcs in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29100

  Product name: Recombinant human PRKDC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 3979-4128 aa of NM_006904

  Sequence: LMYSIMVHALRAFRSDPGLLTNTMDVFVKEPSFDWKNFEQKMLKKGGSWIQEINVAEKNWYPRQKICYAKRKLAGANPAVITCDELLLGHEKAPAFRDYVAVARGSKDHNIRAQEPESGLSEETQVKCLMDQATDPNILGRTWEGWEPWM

• Full Name: protein kinase, DNA-activated, catalytic polypeptide
• Calculated Molecular Weight: 469 kDa
• Observed Molecular Weight: 350-460 kDa
• GenBank Accession Number: NM_006904
• Gene Symbol: PRKDC
• Gene ID (NCBI): 5591
• RRID: AB_3084116
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P78527
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.